BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1101X (426 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 1.6 EU019710-1|ABU25222.1| 475|Tribolium castaneum dopa decarboxyla... 22 2.2 AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 ... 21 3.8 DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc gr... 20 8.7 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 20 8.7 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.6 bits (46), Expect = 1.6 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -2 Query: 413 NKTSAPSPFTVKPSTSAG 360 N + P P T+KP+T+ G Sbjct: 2205 NDKTKPKPTTMKPTTTIG 2222 >EU019710-1|ABU25222.1| 475|Tribolium castaneum dopa decarboxylase protein. Length = 475 Score = 22.2 bits (45), Expect = 2.2 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = -1 Query: 123 NPLKFAVLTHVCSTLWV 73 NP K+ ++ CST+W+ Sbjct: 300 NPHKWLLVNFDCSTMWL 316 >AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 protein protein. Length = 301 Score = 21.4 bits (43), Expect = 3.8 Identities = 13/47 (27%), Positives = 23/47 (48%) Frame = +2 Query: 176 HMSCSRRLDGTLASTSLLHNHSNTCSSAAG*RRFTRKVKENW*SS*Q 316 H+S T+AS + ++ +++ S A FT + +W SS Q Sbjct: 194 HVSTGSTSSPTIASATYTNSANSSIWSPASIDSFTLEQHRSWCSSSQ 240 >DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc growth factor 4 protein. Length = 431 Score = 20.2 bits (40), Expect = 8.7 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = -1 Query: 150 FTAVCVRLTNPLK 112 + VCV+L NP K Sbjct: 330 YPEVCVKLANPQK 342 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 20.2 bits (40), Expect = 8.7 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -3 Query: 196 PSRAAHVPYTPSKVAFHSRL 137 P A+H+PY + VA S L Sbjct: 280 PIGASHLPYFAAAVAAASNL 299 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 95,528 Number of Sequences: 336 Number of extensions: 2006 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 51 effective length of database: 105,449 effective search space used: 9490410 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -