BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1101X (426 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_34899| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.00019) 28 2.8 SB_23460| Best HMM Match : 7tm_1 (HMM E-Value=0.44) 28 3.7 SB_2014| Best HMM Match : MAM (HMM E-Value=0) 27 4.9 SB_59075| Best HMM Match : Helicase_C (HMM E-Value=1.3e-19) 27 6.5 SB_20583| Best HMM Match : RCC1 (HMM E-Value=6.2e-08) 27 6.5 SB_59148| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 >SB_34899| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.00019) Length = 1136 Score = 28.3 bits (60), Expect = 2.8 Identities = 12/29 (41%), Positives = 20/29 (68%) Frame = -1 Query: 198 NLREQLMCHIPLVKSRFTAVCVRLTNPLK 112 N++EQ++ +P+ +RF +VC L N LK Sbjct: 841 NMKEQMLSMVPV--ARFESVCEELNNALK 867 >SB_23460| Best HMM Match : 7tm_1 (HMM E-Value=0.44) Length = 267 Score = 27.9 bits (59), Expect = 3.7 Identities = 10/38 (26%), Positives = 23/38 (60%) Frame = -1 Query: 408 NFSTVSLYSKAFDFSRERLDLLCFAFSNYFFCQELYQF 295 +FST+ ++S +S ++ F F + +C++L++F Sbjct: 101 HFSTLLVFSNILMYSNSAINPFIFVFLHSRYCKDLFRF 138 >SB_2014| Best HMM Match : MAM (HMM E-Value=0) Length = 2282 Score = 27.5 bits (58), Expect = 4.9 Identities = 16/45 (35%), Positives = 29/45 (64%), Gaps = 4/45 (8%) Frame = +1 Query: 208 PGFHQLATQPFQYLQLGCGLKALHTK----GERELVEFLTEEIVA 330 PG H+L++ F+YLQ+ G + L TK G++E ++TE +++ Sbjct: 762 PG-HRLSSAAFEYLQVDLGSEKLITKVSTQGKQEFDFWVTEYVLS 805 >SB_59075| Best HMM Match : Helicase_C (HMM E-Value=1.3e-19) Length = 445 Score = 27.1 bits (57), Expect = 6.5 Identities = 15/65 (23%), Positives = 31/65 (47%) Frame = +1 Query: 220 QLATQPFQYLQLGCGLKALHTKGERELVEFLTEEIVAERKAQKVKSLPAEVEGFTVKGDG 399 QL ++ + L+A+H + E VEF + E +++++P ++E V+ + Sbjct: 286 QLEAMHVEFEAMHVQLEAMHVQFEAMHVEFEAMHVEFEAMHVQLEAMPVQLEAMPVQFEA 345 Query: 400 AEVLF 414 V F Sbjct: 346 MPVQF 350 >SB_20583| Best HMM Match : RCC1 (HMM E-Value=6.2e-08) Length = 970 Score = 27.1 bits (57), Expect = 6.5 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Frame = -2 Query: 407 TSAPSPFTVKPSTSAGRDLTFCALR-SATISSVRNSTSSLSPFV*SAFNP 261 TS P+PFTV D+T C L S +V S L+P++ A P Sbjct: 318 TSLPNPFTVYHDDVGIIDVTTCCLSGSPPGEAVNTSCELLTPWLDKALIP 367 >SB_59148| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 469 Score = 26.6 bits (56), Expect = 8.6 Identities = 12/28 (42%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Frame = -2 Query: 275 SAFNPQ-PSCKYWNGCVASWWKPGSHLT 195 S NP P+ K+W+GC W P HL+ Sbjct: 342 SRVNPTAPAMKFWSGCYLR-WLPTVHLS 368 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,802,836 Number of Sequences: 59808 Number of extensions: 258571 Number of successful extensions: 1139 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1058 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1139 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 814166562 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -