BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1101X (426 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF519528-1|ABP73591.1| 250|Anopheles gambiae APL2 protein. 23 4.5 EF519526-1|ABP73589.1| 250|Anopheles gambiae APL2 protein. 23 4.5 EF519525-1|ABP73588.1| 250|Anopheles gambiae APL2 protein. 23 4.5 EF519523-1|ABP73586.1| 250|Anopheles gambiae APL2 protein. 23 4.5 EF519522-1|ABP73585.1| 250|Anopheles gambiae APL2 protein. 23 4.5 EF519521-1|ABP73584.1| 250|Anopheles gambiae APL2 protein. 23 4.5 EF519519-1|ABP73582.1| 250|Anopheles gambiae APL2 protein. 23 4.5 EF519517-1|ABP73580.1| 250|Anopheles gambiae APL2 protein. 23 4.5 EF519515-1|ABP73578.1| 250|Anopheles gambiae APL2 protein. 23 4.5 EF519514-1|ABP73577.1| 250|Anopheles gambiae APL2 protein. 23 4.5 EF519511-1|ABP73574.1| 250|Anopheles gambiae APL2 protein. 23 4.5 EF519510-1|ABP73573.1| 250|Anopheles gambiae APL2 protein. 23 4.5 EF519509-1|ABP73572.1| 250|Anopheles gambiae APL2 protein. 23 4.5 EF519507-1|ABP73570.1| 250|Anopheles gambiae APL2 protein. 23 4.5 EF519524-1|ABP73587.1| 250|Anopheles gambiae APL2 protein. 23 6.0 EF519520-1|ABP73583.1| 250|Anopheles gambiae APL2 protein. 23 6.0 EF519513-1|ABP73576.1| 250|Anopheles gambiae APL2 protein. 23 6.0 EF519516-1|ABP73579.1| 250|Anopheles gambiae APL2 protein. 22 7.9 EF519512-1|ABP73575.1| 250|Anopheles gambiae APL2 protein. 22 7.9 EF519508-1|ABP73571.1| 250|Anopheles gambiae APL2 protein. 22 7.9 >EF519528-1|ABP73591.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 23.0 bits (47), Expect = 4.5 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = -1 Query: 288 TFRVKRLQPAAELQVLEWLCSKLVEARVPSNLRE 187 TF V + + +++ +KL R+P NLR+ Sbjct: 127 TFNVAQFERRWSFDLIDASXNKLSVVRIPPNLRQ 160 >EF519526-1|ABP73589.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 23.0 bits (47), Expect = 4.5 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = -1 Query: 288 TFRVKRLQPAAELQVLEWLCSKLVEARVPSNLRE 187 TF V + + +++ +KL R+P NLR+ Sbjct: 127 TFNVAQFERRWSFDLIDASXNKLSVVRIPPNLRQ 160 >EF519525-1|ABP73588.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 23.0 bits (47), Expect = 4.5 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = -1 Query: 288 TFRVKRLQPAAELQVLEWLCSKLVEARVPSNLRE 187 TF V + + +++ +KL R+P NLR+ Sbjct: 127 TFNVAQFERRWSFDLIDASXNKLSVVRIPPNLRQ 160 >EF519523-1|ABP73586.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 23.0 bits (47), Expect = 4.5 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = -1 Query: 288 TFRVKRLQPAAELQVLEWLCSKLVEARVPSNLRE 187 TF V + + +++ +KL R+P NLR+ Sbjct: 127 TFNVAQFERRWSFDLIDASXNKLSVVRIPPNLRQ 160 >EF519522-1|ABP73585.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 23.0 bits (47), Expect = 4.5 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = -1 Query: 288 TFRVKRLQPAAELQVLEWLCSKLVEARVPSNLRE 187 TF V + + +++ +KL R+P NLR+ Sbjct: 127 TFNVAQFERRWSFDLIDASXNKLSVVRIPPNLRQ 160 >EF519521-1|ABP73584.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 23.0 bits (47), Expect = 4.5 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = -1 Query: 288 TFRVKRLQPAAELQVLEWLCSKLVEARVPSNLRE 187 TF V + + +++ +KL R+P NLR+ Sbjct: 127 TFNVAQFERRWSFDLIDASXNKLSVVRIPPNLRQ 160 >EF519519-1|ABP73582.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 23.0 bits (47), Expect = 4.5 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = -1 Query: 288 TFRVKRLQPAAELQVLEWLCSKLVEARVPSNLRE 187 TF V + + +++ +KL R+P NLR+ Sbjct: 127 TFNVAQFERRWSFDLIDASXNKLSVVRIPPNLRQ 160 >EF519517-1|ABP73580.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 23.0 bits (47), Expect = 4.5 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = -1 Query: 288 TFRVKRLQPAAELQVLEWLCSKLVEARVPSNLRE 187 TF V + + +++ +KL R+P NLR+ Sbjct: 127 TFNVAQFERRWSFDLIDASXNKLSVVRIPPNLRQ 160 >EF519515-1|ABP73578.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 23.0 bits (47), Expect = 4.5 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = -1 Query: 288 TFRVKRLQPAAELQVLEWLCSKLVEARVPSNLRE 187 TF V + + +++ +KL R+P NLR+ Sbjct: 127 TFNVAQFERRWSFDLIDASXNKLSVVRIPPNLRQ 160 >EF519514-1|ABP73577.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 23.0 bits (47), Expect = 4.5 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = -1 Query: 288 TFRVKRLQPAAELQVLEWLCSKLVEARVPSNLRE 187 TF V + + +++ +KL R+P NLR+ Sbjct: 127 TFNVAQFERRWSFDLIDASXNKLSVVRIPPNLRQ 160 >EF519511-1|ABP73574.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 23.0 bits (47), Expect = 4.5 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = -1 Query: 288 TFRVKRLQPAAELQVLEWLCSKLVEARVPSNLRE 187 TF V + + +++ +KL R+P NLR+ Sbjct: 127 TFNVAQFERRWSFDLIDASXNKLSVVRIPPNLRQ 160 >EF519510-1|ABP73573.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 23.0 bits (47), Expect = 4.5 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = -1 Query: 288 TFRVKRLQPAAELQVLEWLCSKLVEARVPSNLRE 187 TF V + + +++ +KL R+P NLR+ Sbjct: 127 TFNVAQFERRWSFDLIDASXNKLSVVRIPPNLRQ 160 >EF519509-1|ABP73572.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 23.0 bits (47), Expect = 4.5 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = -1 Query: 288 TFRVKRLQPAAELQVLEWLCSKLVEARVPSNLRE 187 TF V + + +++ +KL R+P NLR+ Sbjct: 127 TFNVAQFERRWSFDLIDASXNKLSVVRIPXNLRQ 160 >EF519507-1|ABP73570.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 23.0 bits (47), Expect = 4.5 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = -1 Query: 288 TFRVKRLQPAAELQVLEWLCSKLVEARVPSNLRE 187 TF V + + +++ +KL R+P NLR+ Sbjct: 127 TFNVAQFERRWSFDLIDASXNKLSVVRIPXNLRQ 160 >EF519524-1|ABP73587.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 22.6 bits (46), Expect = 6.0 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = -1 Query: 288 TFRVKRLQPAAELQVLEWLCSKLVEARVPSNLRE 187 TF V + + +++ +KL R+P NLR+ Sbjct: 127 TFNVAQFERRWSFDLIDASYNKLSVVRIPPNLRQ 160 >EF519520-1|ABP73583.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 22.6 bits (46), Expect = 6.0 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = -1 Query: 288 TFRVKRLQPAAELQVLEWLCSKLVEARVPSNLRE 187 TF V + + +++ +KL R+P NLR+ Sbjct: 127 TFNVAQFERRWSFDLIDASYNKLSVVRIPPNLRQ 160 >EF519513-1|ABP73576.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 22.6 bits (46), Expect = 6.0 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = -1 Query: 288 TFRVKRLQPAAELQVLEWLCSKLVEARVPSNLRE 187 TF V + + +++ +KL R+P NLR+ Sbjct: 127 TFNVAQFERRWSFDLIDASYNKLSVVRIPPNLRQ 160 >EF519516-1|ABP73579.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 22.2 bits (45), Expect = 7.9 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = -1 Query: 288 TFRVKRLQPAAELQVLEWLCSKLVEARVPSNLRE 187 TF V + + +++ +KL R+P NLR+ Sbjct: 127 TFNVAQFERRWSFDLIDASHNKLSVVRIPPNLRQ 160 >EF519512-1|ABP73575.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 22.2 bits (45), Expect = 7.9 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = -1 Query: 288 TFRVKRLQPAAELQVLEWLCSKLVEARVPSNLRE 187 TF V + + +++ +KL R+P NLR+ Sbjct: 127 TFNVAQFERRWSFDLIDASHNKLSVVRIPPNLRQ 160 >EF519508-1|ABP73571.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 22.2 bits (45), Expect = 7.9 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = -1 Query: 288 TFRVKRLQPAAELQVLEWLCSKLVEARVPSNLRE 187 TF V + + +++ +KL R+P NLR+ Sbjct: 127 TFNVAQFERRWSFDLIDASHNKLSVVRIPPNLRQ 160 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 432,187 Number of Sequences: 2352 Number of extensions: 8784 Number of successful extensions: 49 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 49 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 49 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 34867302 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -