BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1096 (419 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z83107-7|CAB05501.2| 537|Caenorhabditis elegans Hypothetical pr... 27 4.1 Z74034-2|CAE17843.1| 323|Caenorhabditis elegans Hypothetical pr... 27 5.5 >Z83107-7|CAB05501.2| 537|Caenorhabditis elegans Hypothetical protein F32A7.6 protein. Length = 537 Score = 27.5 bits (58), Expect = 4.1 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = +1 Query: 124 GRNVVTN-FVRNHSNGGIPGENLPFDIHNRYKLTLYFILYAGSG 252 GRN N FV NGG+ G+N +D + + TL F + SG Sbjct: 264 GRNGKGNIFVWASGNGGVNGDNCAYDGYVSNEYTLSFGVIDASG 307 >Z74034-2|CAE17843.1| 323|Caenorhabditis elegans Hypothetical protein F43A11.4 protein. Length = 323 Score = 27.1 bits (57), Expect = 5.5 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = -1 Query: 185 FSPGIPPLEWFLTKFVTTFLPSLFEMRVSGVIIFTFLR 72 FSP PL WF +T + +F + + +II +F+R Sbjct: 3 FSPDADPLNWFAASVMT--INGVFGITCNTLIIASFIR 38 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,115,750 Number of Sequences: 27780 Number of extensions: 179109 Number of successful extensions: 354 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 347 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 354 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 682028672 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -