BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1096 (419 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g50260.1 68414.m05635 C2 domain-containing protein low simila... 29 1.7 At5g05170.1 68418.m00550 cellulose synthase, catalytic subunit (... 28 3.0 At2g36270.1 68415.m04452 bZIP transcription factor family protei... 26 9.0 >At1g50260.1 68414.m05635 C2 domain-containing protein low similarity to CLB1 [Lycopersicon esculentum] GI:2789434; contains Pfam profile PF00168: C2 domain Length = 675 Score = 28.7 bits (61), Expect = 1.7 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = -1 Query: 176 GIPPLEWFLTKFVTTFLPSLF 114 GIP L FLTK +T LP LF Sbjct: 344 GIPVLSMFLTKLLTVDLPRLF 364 >At5g05170.1 68418.m00550 cellulose synthase, catalytic subunit (Ath-B) nearly identical to gi:2827143, cellulose synthase, catalytic subunit (Ath-B) Length = 1065 Score = 27.9 bits (59), Expect = 3.0 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -1 Query: 158 WFLTKFVTTFLPSLFEMRVSGV 93 WFL+ F++ F + EMR SGV Sbjct: 879 WFLSLFLSIFATGILEMRWSGV 900 >At2g36270.1 68415.m04452 bZIP transcription factor family protein / ABA-responsive element-binding protein, putative similar to ABA-responsive element binding protein 1 (AREB1) GI:9967417 from [Arabidopsis thaliana]; contains a bZIP transcription factor basic domain signature (PDOC00036) Length = 442 Score = 26.2 bits (55), Expect = 9.0 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 4/50 (8%) Frame = +1 Query: 88 MITPLTRISNKLGRNVVTNFVRNHSNGGIPGENLPFDIHNR----YKLTL 225 M+T T+++++ R V ++ + NGG GEN PF R Y LTL Sbjct: 1 MVTRETKLTSE--REVESSMAQARHNGGGGGENHPFTSLGRQSSIYSLTL 48 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,363,944 Number of Sequences: 28952 Number of extensions: 162015 Number of successful extensions: 337 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 334 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 337 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 645327280 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -