BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1089 (757 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC26A3.04 |rpl2002|rpl20, rpl20-2|60S ribosomal protein L20|Sc... 27 2.9 SPAC3A12.10 |rpl2001|rpl20-1, rpl20, yl17b, rpl18a-2|60S ribosom... 27 2.9 SPBC3B8.06 |||conserved fungal protein|Schizosaccharomyces pombe... 26 6.7 >SPAC26A3.04 |rpl2002|rpl20, rpl20-2|60S ribosomal protein L20|Schizosaccharomyces pombe|chr 1|||Manual Length = 176 Score = 27.1 bits (57), Expect = 2.9 Identities = 9/31 (29%), Positives = 20/31 (64%) Frame = -1 Query: 142 RRFRPASRLFLIKILHHNRSVKHRMRFKKIR 50 + FR +R+ ++ ++ + + +HR RF+ IR Sbjct: 91 KEFRDTTRVGAVEAMYADMAARHRARFRSIR 121 >SPAC3A12.10 |rpl2001|rpl20-1, rpl20, yl17b, rpl18a-2|60S ribosomal protein L20a|Schizosaccharomyces pombe|chr 1|||Manual Length = 176 Score = 27.1 bits (57), Expect = 2.9 Identities = 9/31 (29%), Positives = 20/31 (64%) Frame = -1 Query: 142 RRFRPASRLFLIKILHHNRSVKHRMRFKKIR 50 + FR +R+ ++ ++ + + +HR RF+ IR Sbjct: 91 KEFRDTTRVGAVEAMYADMAARHRARFRSIR 121 >SPBC3B8.06 |||conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 511 Score = 25.8 bits (54), Expect = 6.7 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = -1 Query: 238 NLLPLDMVHKYFAEYVTTKDLPSSW 164 N++P + K FA+YV TK++ S+ Sbjct: 277 NVVPKQLSEKRFAKYVPTKEMVESF 301 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,730,194 Number of Sequences: 5004 Number of extensions: 48721 Number of successful extensions: 126 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 123 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 126 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 361294920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -