BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1089 (757 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_29735| Best HMM Match : Kunitz_BPTI (HMM E-Value=2.7) 30 2.3 SB_29616| Best HMM Match : Orthopox_F14 (HMM E-Value=1.2) 30 2.3 SB_48467| Best HMM Match : F5_F8_type_C (HMM E-Value=1.4e-21) 29 5.4 SB_49533| Best HMM Match : Ldh_2 (HMM E-Value=0) 28 9.4 >SB_29735| Best HMM Match : Kunitz_BPTI (HMM E-Value=2.7) Length = 211 Score = 29.9 bits (64), Expect = 2.3 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -1 Query: 559 YQIKRTCNYKDKCRVLCA*AKYR 491 Y ++RTC KD CR +C K R Sbjct: 101 YAVRRTCGDKDDCRKICTDPKLR 123 >SB_29616| Best HMM Match : Orthopox_F14 (HMM E-Value=1.2) Length = 171 Score = 29.9 bits (64), Expect = 2.3 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -1 Query: 559 YQIKRTCNYKDKCRVLCA*AKYR 491 Y ++RTC KD CR +C K R Sbjct: 37 YAVRRTCGDKDDCRKICTDPKLR 59 >SB_48467| Best HMM Match : F5_F8_type_C (HMM E-Value=1.4e-21) Length = 418 Score = 28.7 bits (61), Expect = 5.4 Identities = 16/53 (30%), Positives = 25/53 (47%) Frame = +1 Query: 409 DPTKNSVGCDCGLVYSSQATGSTRTVTGGIWLKHITRDIYLCNYRSVLFGIII 567 +P K DCG+ Y+S G T G W ++ +YL +Y V G ++ Sbjct: 240 EPAKPKPRFDCGIKYTSNIIGGTDAAVGE-WPWQVS--LYLTHYGPVCGGTLL 289 >SB_49533| Best HMM Match : Ldh_2 (HMM E-Value=0) Length = 883 Score = 27.9 bits (59), Expect = 9.4 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = -3 Query: 299 SSDNADVASQGYQHSRKKTKQPFTPRY 219 + D+ D G RKK+KQP TP Y Sbjct: 854 ADDDDDSDDNGIHDRRKKSKQPGTPAY 880 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,106,890 Number of Sequences: 59808 Number of extensions: 349976 Number of successful extensions: 704 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 680 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 704 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2058295707 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -