BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1089 (757 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z83216-2|CAB05673.1| 315|Caenorhabditis elegans Hypothetical pr... 29 3.6 U28733-2|AAA68303.3| 381|Caenorhabditis elegans Hypothetical pr... 29 4.7 >Z83216-2|CAB05673.1| 315|Caenorhabditis elegans Hypothetical protein C08F11.2 protein. Length = 315 Score = 29.1 bits (62), Expect = 3.6 Identities = 11/42 (26%), Positives = 23/42 (54%) Frame = -1 Query: 127 ASRLFLIKILHHNRSVKHRMRFKKIRNMHGPCVFKFIGVSLI 2 A+ +F + ++ +NR K +R + + +H P F +SL+ Sbjct: 32 ANNIFFVLLIVYNRRKKLDLRDQGFKELHAPIFINFFFISLV 73 >U28733-2|AAA68303.3| 381|Caenorhabditis elegans Hypothetical protein C54A12.2 protein. Length = 381 Score = 28.7 bits (61), Expect = 4.7 Identities = 13/41 (31%), Positives = 24/41 (58%) Frame = +3 Query: 168 EEGKSFVVTYSAKYLCTISRGKRLFGFFPTMLIALRGYISV 290 +E +SFVV Y+AKY+ + + + +LI + +I+V Sbjct: 151 DEQRSFVVAYTAKYVYPLCMMAKTCSLYIMVLITIERWIAV 191 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,974,700 Number of Sequences: 27780 Number of extensions: 270394 Number of successful extensions: 616 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 598 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 616 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1798543458 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -