BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1088 (415 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_35451| Best HMM Match : Ribosomal_L36e (HMM E-Value=0) 77 8e-15 SB_3539| Best HMM Match : rve (HMM E-Value=5.6e-11) 32 0.16 SB_2438| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.21 SB_26477| Best HMM Match : GST_C (HMM E-Value=0.97) 30 0.66 SB_6230| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.1 SB_19393| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_5982| Best HMM Match : PAP2 (HMM E-Value=8.3e-19) 27 4.6 SB_31885| Best HMM Match : RVT_1 (HMM E-Value=4.6e-28) 27 4.6 SB_27155| Best HMM Match : Dynein_heavy (HMM E-Value=1.1e-09) 27 4.6 SB_24| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.1 >SB_35451| Best HMM Match : Ribosomal_L36e (HMM E-Value=0) Length = 100 Score = 76.6 bits (180), Expect = 8e-15 Identities = 41/74 (55%), Positives = 49/74 (66%) Frame = +2 Query: 32 IAVGLRKGHKTTKISAGRKGITDKAIRIRPARLKGLQTKHSKFVRDLVREVVGHAQYEKR 211 +AVGL+KGHK TK + +P+R KG K KFVRD+VREVVG A YEKR Sbjct: 1 MAVGLQKGHKVTK----------NVTKPKPSRRKGASNKRVKFVRDVVREVVGFAPYEKR 50 Query: 212 AMELLKVSKDKRAL 253 MELL++ KDKRAL Sbjct: 51 VMELLRIGKDKRAL 64 Score = 48.4 bits (110), Expect = 2e-06 Identities = 21/35 (60%), Positives = 28/35 (80%) Frame = +1 Query: 235 KRQACSEFLKRRLGTHIRAKRKREELSNVLAQMRK 339 K + +F K+RLGTH+R KRKREE+++VLA MRK Sbjct: 59 KDKRALKFCKKRLGTHVRGKRKREEITSVLAAMRK 93 >SB_3539| Best HMM Match : rve (HMM E-Value=5.6e-11) Length = 519 Score = 32.3 bits (70), Expect = 0.16 Identities = 20/80 (25%), Positives = 39/80 (48%), Gaps = 1/80 (1%) Frame = +2 Query: 95 TDKAIRIRPARLKGLQTKHSKFVRDLVREVVGHAQY-EKRAMELLKVSKDKRALSS*SDD 271 +DK +R+ P +++ + + + V+ ++G A+Y K L ++K R L+ D Sbjct: 190 SDKGLRVDPDKVRAITEMPTITDKAAVKRLLGLAEYLAKFLPHLSDLTKPLRDLTQKEAD 249 Query: 272 WAHTSAPRGSVKNLATCSLR 331 W S R +++NL R Sbjct: 250 WVWDSPQRTAMENLKAAITR 269 >SB_2438| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1086 Score = 31.9 bits (69), Expect = 0.21 Identities = 19/74 (25%), Positives = 38/74 (51%), Gaps = 1/74 (1%) Frame = +2 Query: 95 TDKAIRIRPARLKGLQTKHSKFVRDLVREVVGHAQY-EKRAMELLKVSKDKRALSS*SDD 271 +DK +R+ P +++ + + + V+ ++G AQY K L ++K R L+ D Sbjct: 558 SDKGLRVDPDKVRAITEMTTPTDKAAVQRLLGLAQYLAKFLPHLSDLTKPLRDLTQKEAD 617 Query: 272 WAHTSAPRGSVKNL 313 W S + +++NL Sbjct: 618 WVWDSPQQTAMENL 631 >SB_26477| Best HMM Match : GST_C (HMM E-Value=0.97) Length = 971 Score = 30.3 bits (65), Expect = 0.66 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = -3 Query: 278 VPNRRFKNSEHACLLTP*VTP*PSSHIERVRQLRVLNHGQTW 153 +P R +S A L+ P PS ++ R+ R NHG+TW Sbjct: 771 LPTERDYSSALAALMRKAKQPKPSPNLVHTRRERPRNHGRTW 812 >SB_6230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 29.5 bits (63), Expect = 1.1 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = +2 Query: 131 KGLQTKHSKFVRDLVREVVGHAQYEKRAMELLKVSKDK 244 +GL+ K + ++ E GHA Y+K L KVS+++ Sbjct: 32 RGLRKVSRKHAQRILDETAGHASYKKEHRGLRKVSREQ 69 Score = 27.1 bits (57), Expect = 6.1 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +2 Query: 131 KGLQTKHSKFVRDLVREVVGHAQYEKRAMELLKVSK 238 +GL+ K R ++ E GH Y+K L KVS+ Sbjct: 88 RGLRKVSRKHARRILDETAGHNTYKKEHRGLRKVSR 123 >SB_19393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1660 Score = 27.9 bits (59), Expect = 3.5 Identities = 28/81 (34%), Positives = 36/81 (44%), Gaps = 12/81 (14%) Frame = +2 Query: 38 VGLRKGHKTT-----KISAGRKGITDKAIRIRPARLKGLQ----TKHS---KFVRDLVRE 181 V RKGHK T + G+KGI K R+ +R Q KHS K +R +RE Sbjct: 1109 VSTRKGHKRTENYNDRKRDGKKGIDGKRERLSSSRSDDFQQSKMIKHSHLEKSLRQAMRE 1168 Query: 182 VVGHAQYEKRAMELLKVSKDK 244 + H+ E KV K K Sbjct: 1169 -LEHSSENSSEEEKRKVRKKK 1188 >SB_5982| Best HMM Match : PAP2 (HMM E-Value=8.3e-19) Length = 320 Score = 27.5 bits (58), Expect = 4.6 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = -2 Query: 285 DVCAQSSLQELRARLSFDTLSNSIALF 205 DVC +L RARLSF +++ +A++ Sbjct: 171 DVCTGDALDVKRARLSFPSVNTLVAMY 197 >SB_31885| Best HMM Match : RVT_1 (HMM E-Value=4.6e-28) Length = 922 Score = 27.5 bits (58), Expect = 4.6 Identities = 16/55 (29%), Positives = 31/55 (56%), Gaps = 1/55 (1%) Frame = +2 Query: 95 TDKAIRIRPARLKGLQTKHSKFVRDLVREVVGHAQY-EKRAMELLKVSKDKRALS 256 TDK +++ PA+++ + S + V+ ++G AQY K +L ++K R L+ Sbjct: 659 TDKGLKVDPAKVRAIVDMPSPTDKLGVQRLLGLAQYLAKSCPQLSDITKPLRDLT 713 >SB_27155| Best HMM Match : Dynein_heavy (HMM E-Value=1.1e-09) Length = 1248 Score = 27.5 bits (58), Expect = 4.6 Identities = 13/44 (29%), Positives = 24/44 (54%) Frame = +2 Query: 116 RPARLKGLQTKHSKFVRDLVREVVGHAQYEKRAMELLKVSKDKR 247 RP +L+ ++ + +VR L + G +Y + L++ SKD R Sbjct: 625 RPNKLQVIKLSDANYVRTLENSIQGGIEYLRLGDHLVEFSKDFR 668 >SB_24| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1246 Score = 27.1 bits (57), Expect = 6.1 Identities = 16/55 (29%), Positives = 31/55 (56%), Gaps = 1/55 (1%) Frame = +2 Query: 95 TDKAIRIRPARLKGLQTKHSKFVRDLVREVVGHAQY-EKRAMELLKVSKDKRALS 256 TDK +++ PA+++ + S + V+ ++G AQY K +L ++K R L+ Sbjct: 618 TDKGLKVNPAKVRAIVDMPSPTDKLGVQRLLGLAQYLAKFLPQLSDITKPLRDLT 672 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,594,508 Number of Sequences: 59808 Number of extensions: 219235 Number of successful extensions: 557 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 513 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 555 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 764823134 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -