BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1087 (779 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_04_0161 - 15232074-15232139,15232299-15232406,15233417-152335... 34 0.15 03_02_0838 + 11641484-11642030,11643614-11643650,11643784-116438... 30 2.4 >09_04_0161 - 15232074-15232139,15232299-15232406,15233417-15233506, 15233617-15233733,15234408-15234527,15234930-15236168 Length = 579 Score = 33.9 bits (74), Expect = 0.15 Identities = 18/43 (41%), Positives = 23/43 (53%) Frame = +2 Query: 443 RPDKLHSQYSSPRYSARRHVIASENTVLEGSFQSRMVLSTKDT 571 RP S+ S+P A R V NTV EG SR + ST++T Sbjct: 86 RPSTPSSRVSTPSTPASRSVTPVRNTVTEGHKSSRRITSTRNT 128 >03_02_0838 + 11641484-11642030,11643614-11643650,11643784-11643841, 11646176-11646265,11646796-11646913,11648093-11648277, 11648330-11648455,11648578-11648634,11648741-11648821, 11649068-11649102,11649265-11649354,11649443-11649599, 11649785-11649901 Length = 565 Score = 29.9 bits (64), Expect = 2.4 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +3 Query: 15 LLSGSRFRSGGRFCEHSSC 71 LL G+ FR G++CEH+ C Sbjct: 169 LLVGNSFRGSGKYCEHAVC 187 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,846,371 Number of Sequences: 37544 Number of extensions: 326234 Number of successful extensions: 665 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 651 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 663 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2091906552 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -