BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1087 (779 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56265| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_41168| Best HMM Match : Borrelia_orfA (HMM E-Value=0.77) 28 9.8 >SB_56265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 28.3 bits (60), Expect = 7.4 Identities = 15/41 (36%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -2 Query: 259 DQLPLRYKFWRK*KFYC-LNYIFLVFFFTFIPKVRTLRGYF 140 D L + F+R C + Y + VF+ F+P VR GYF Sbjct: 68 DVLGSMFPFYRVFFTRCFIGYFYPVFYRVFLPDVRCFIGYF 108 >SB_41168| Best HMM Match : Borrelia_orfA (HMM E-Value=0.77) Length = 738 Score = 27.9 bits (59), Expect = 9.8 Identities = 12/36 (33%), Positives = 23/36 (63%) Frame = +2 Query: 362 LRQSQKAKKTRKANFKNYLRQKSNMLVRPDKLHSQY 469 LRQ Q A + R+A + R++ M+++ K+HS++ Sbjct: 141 LRQRQAAARKRRARARARARRERLMILKMKKIHSRH 176 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,218,585 Number of Sequences: 59808 Number of extensions: 399406 Number of successful extensions: 880 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 787 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 880 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2131907602 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -