BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1087 (779 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant r... 27 0.86 AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking p... 25 3.5 >AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant receptor Or3 protein. Length = 411 Score = 26.6 bits (56), Expect = 0.86 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = -2 Query: 220 KFYCLNYIFLVFFFTFIPKVRTLRGYFSV 134 K YC + + FF F+P T YF+V Sbjct: 146 KIYCCCHFSMATFFWFMPVWTTYSAYFAV 174 >AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking protein. Length = 932 Score = 24.6 bits (51), Expect = 3.5 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = -1 Query: 668 FRSSLFTILTTSIRAYFIYTIWNHCAHPKSVTRYLL 561 F ++ T+ T S A F YT+W K+VTR ++ Sbjct: 79 FEKNVSTVATCSRTAPFCYTLWTFDI-VKNVTRVVV 113 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 722,932 Number of Sequences: 2352 Number of extensions: 14472 Number of successful extensions: 17 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 81497388 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -