BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1087 (779 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY070535-1|AAL48006.1| 428|Drosophila melanogaster LD05179p pro... 29 9.5 AL021728-7|CAA16816.1| 415|Drosophila melanogaster EG:95B7.3 pr... 29 9.5 AE014298-458|AAF45820.2| 428|Drosophila melanogaster CG2713-PA ... 29 9.5 >AY070535-1|AAL48006.1| 428|Drosophila melanogaster LD05179p protein. Length = 428 Score = 28.7 bits (61), Expect = 9.5 Identities = 18/76 (23%), Positives = 33/76 (43%), Gaps = 1/76 (1%) Frame = +2 Query: 263 IVANLFVPIRFGISQSIPSLNFIRVADHFLYSPLRQSQKAKKTRKANF-KNYLRQKSNML 439 + A + FG + P N + D F + PL Q + + ++ + +++ S Sbjct: 157 VAAGFWAVYEFGKPEVDP--NGQPIEDEFTHKPLVQQYLQRMWKSIHYYQRMIQEPSRAK 214 Query: 440 VRPDKLHSQYSSPRYS 487 + PD L Y PRY+ Sbjct: 215 LLPDPLKPPYVQPRYT 230 >AL021728-7|CAA16816.1| 415|Drosophila melanogaster EG:95B7.3 protein. Length = 415 Score = 28.7 bits (61), Expect = 9.5 Identities = 18/76 (23%), Positives = 33/76 (43%), Gaps = 1/76 (1%) Frame = +2 Query: 263 IVANLFVPIRFGISQSIPSLNFIRVADHFLYSPLRQSQKAKKTRKANF-KNYLRQKSNML 439 + A + FG + P N + D F + PL Q + + ++ + +++ S Sbjct: 157 VAAGFWAVYEFGKPEVDP--NGQPIEDEFTHKPLVQQYLQRMWKSIHYYQRMIQEPSRAK 214 Query: 440 VRPDKLHSQYSSPRYS 487 + PD L Y PRY+ Sbjct: 215 LLPDPLKPPYVQPRYT 230 >AE014298-458|AAF45820.2| 428|Drosophila melanogaster CG2713-PA protein. Length = 428 Score = 28.7 bits (61), Expect = 9.5 Identities = 18/76 (23%), Positives = 33/76 (43%), Gaps = 1/76 (1%) Frame = +2 Query: 263 IVANLFVPIRFGISQSIPSLNFIRVADHFLYSPLRQSQKAKKTRKANF-KNYLRQKSNML 439 + A + FG + P N + D F + PL Q + + ++ + +++ S Sbjct: 157 VAAGFWAVYEFGKPEVDP--NGQPIEDEFTHKPLVQQYLQRMWKSIHYYQRMIQEPSRAK 214 Query: 440 VRPDKLHSQYSSPRYS 487 + PD L Y PRY+ Sbjct: 215 LLPDPLKPPYVQPRYT 230 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 30,241,130 Number of Sequences: 53049 Number of extensions: 565555 Number of successful extensions: 1145 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1121 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1145 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3623012976 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -