BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1086 (516 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_18396| Best HMM Match : Ribosomal_L35Ae (HMM E-Value=0) 77 7e-15 SB_21444| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_20453| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.0 SB_35470| Best HMM Match : PAN (HMM E-Value=2.9e-08) 28 4.0 SB_36665| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_22619| Best HMM Match : TSP_1 (HMM E-Value=8.5e-14) 27 9.2 SB_252| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 >SB_18396| Best HMM Match : Ribosomal_L35Ae (HMM E-Value=0) Length = 115 Score = 77.4 bits (182), Expect = 7e-15 Identities = 38/61 (62%), Positives = 44/61 (72%) Frame = +2 Query: 251 LLYVYRAKKRTPIPGGPRGKKTKLRAIWGKVTRPHGNSGSVRAKFKSNLPAQAMGHRIRV 430 L +VYRAK +T G K TKLR IWGKVTR HGNSG VRAKF+ NLP +AMG +RV Sbjct: 49 LAFVYRAKNKTVAKGDK--KATKLRVIWGKVTRAHGNSGVVRAKFRHNLPPKAMGATVRV 106 Query: 431 M 433 + Sbjct: 107 I 107 Score = 59.7 bits (138), Expect = 1e-09 Identities = 24/42 (57%), Positives = 31/42 (73%) Frame = +3 Query: 123 RLYAKAVFTGYKRGLRNQHENTALLKVEGAKDRNDAVFYAGK 248 RLY K + G+KRGLRNQH NT+L+K+EG +R + FY GK Sbjct: 6 RLYTKGIVLGFKRGLRNQHPNTSLVKIEGVDERKNTEFYLGK 47 >SB_21444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 333 Score = 29.1 bits (62), Expect = 2.3 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = -1 Query: 399 GRLDLNLARTLPELPCGRVTLPQI 328 G DLN+ +T+P + C R+ P++ Sbjct: 257 GLFDLNIGQTIPSVTCRRIPFPEL 280 >SB_20453| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 4.0 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +3 Query: 231 VFYAGKHCSMCTELRRGHQFPEVPVAKKPSC 323 VF + K S C + + G F VP+AK SC Sbjct: 83 VFLSRKDLSACVKSKPGSLFVAVPLAKSVSC 113 >SB_35470| Best HMM Match : PAN (HMM E-Value=2.9e-08) Length = 614 Score = 28.3 bits (60), Expect = 4.0 Identities = 17/40 (42%), Positives = 20/40 (50%), Gaps = 4/40 (10%) Frame = -3 Query: 388 LELGSDTARVAMWAG----HLAPDSTQLGFFATGTSGNWC 281 L L TA + +W G HLA D + FATG S WC Sbjct: 12 LALRQPTASLNIWEGRAPPHLAVDGVNMSTFATG-STIWC 50 >SB_36665| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1277 Score = 27.5 bits (58), Expect = 6.9 Identities = 18/54 (33%), Positives = 30/54 (55%) Frame = +1 Query: 157 SVVYATSTRTPLSSRLKEQKTVMMQSFMLASIALCVQS*EEDTNSRRSPWQKNQ 318 SV+ TS L+S++ Q++ +++SF+LA V T S SPWQ ++ Sbjct: 601 SVISFTSILIILASQV--QRSRLIESFILAIGLTLVYHYRSATGSLTSPWQHHE 652 >SB_22619| Best HMM Match : TSP_1 (HMM E-Value=8.5e-14) Length = 506 Score = 27.1 bits (57), Expect = 9.2 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = +2 Query: 266 RAKKRTPIPGGPRGKKTKLRAIWGKVTRPHGNSGS 370 R ++R P P PR + WG T GN+G+ Sbjct: 79 RRRRRRPPPCPPRNCAVSAWSSWGPCTHQCGNAGT 113 >SB_252| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 27.1 bits (57), Expect = 9.2 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +2 Query: 254 LYVYRAKKRTPIPGGPRGKKTKLRAIWGKV 343 L + R + PI G PR ++ L IWGK+ Sbjct: 47 LRIRRIIRLKPIRGKPRVRRISLARIWGKL 76 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,360,073 Number of Sequences: 59808 Number of extensions: 339863 Number of successful extensions: 809 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 712 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 806 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1148326654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -