BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1086 (516 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g74270.1 68414.m08601 60S ribosomal protein L35a (RPL35aC) si... 75 2e-14 At1g07070.1 68414.m00753 60S ribosomal protein L35a (RPL35aA) si... 75 2e-14 At3g55750.1 68416.m06194 60S ribosomal protein L35a (RPL35aD) ri... 75 4e-14 At1g41880.1 68414.m04836 60S ribosomal protein L35a (RPL35aB) id... 75 4e-14 At5g45160.1 68418.m05544 root hair defective 3 GTP-binding (RHD3... 29 1.4 At5g44620.1 68418.m05467 cytochrome P450 family protein similar ... 27 5.7 At5g17920.1 68418.m02101 5-methyltetrahydropteroyltriglutamate--... 27 5.7 At4g21130.1 68417.m03055 transducin family protein / WD-40 repea... 27 5.7 At3g05180.1 68416.m00565 GDSL-motif lipase/hydrolase family prot... 27 5.7 At5g51195.1 68418.m06348 hypothetical protein 27 7.5 At2g04350.2 68415.m00434 long-chain-fatty-acid--CoA ligase famil... 27 9.9 At2g04350.1 68415.m00433 long-chain-fatty-acid--CoA ligase famil... 27 9.9 At1g20130.1 68414.m02518 family II extracellular lipase, putativ... 27 9.9 >At1g74270.1 68414.m08601 60S ribosomal protein L35a (RPL35aC) similar to ribosomal protein L33B GB:NP_014877 from [Saccharomyces cerevisiae] Length = 112 Score = 75.4 bits (177), Expect = 2e-14 Identities = 36/67 (53%), Positives = 45/67 (67%) Frame = +2 Query: 251 LLYVYRAKKRTPIPGGPRGKKTKLRAIWGKVTRPHGNSGSVRAKFKSNLPAQAMGHRIRV 430 + Y+Y+AK + + R IWGKVTRPHGNSG VRAKF SNLP ++MG R+RV Sbjct: 54 MAYIYKAKTKK--------NGSHYRCIWGKVTRPHGNSGVVRAKFTSNLPPKSMGSRVRV 105 Query: 431 MLYPSRI 451 +YPS I Sbjct: 106 FMYPSNI 112 Score = 43.6 bits (98), Expect = 8e-05 Identities = 17/42 (40%), Positives = 26/42 (61%) Frame = +3 Query: 123 RLYAKAVFTGYKRGLRNQHENTALLKVEGAKDRNDAVFYAGK 248 RLY + GYKR NQ+ NT+L+++EG + + +Y GK Sbjct: 11 RLYVRGTILGYKRSKSNQYPNTSLVQIEGVNTQEEVNWYKGK 52 >At1g07070.1 68414.m00753 60S ribosomal protein L35a (RPL35aA) similar to ribosomal protein L35a GI:57118 from [Rattus norvegicus] Length = 112 Score = 75.4 bits (177), Expect = 2e-14 Identities = 36/67 (53%), Positives = 45/67 (67%) Frame = +2 Query: 251 LLYVYRAKKRTPIPGGPRGKKTKLRAIWGKVTRPHGNSGSVRAKFKSNLPAQAMGHRIRV 430 + Y+Y+AK + + R IWGKVTRPHGNSG VRAKF SNLP ++MG R+RV Sbjct: 54 MAYIYKAKTKK--------NGSHYRCIWGKVTRPHGNSGVVRAKFTSNLPPKSMGSRVRV 105 Query: 431 MLYPSRI 451 +YPS I Sbjct: 106 FMYPSNI 112 Score = 43.6 bits (98), Expect = 8e-05 Identities = 18/42 (42%), Positives = 25/42 (59%) Frame = +3 Query: 123 RLYAKAVFTGYKRGLRNQHENTALLKVEGAKDRNDAVFYAGK 248 RLY + GYKR NQ+ NT+L++VEG + +Y GK Sbjct: 11 RLYVRGTILGYKRSKSNQYPNTSLVQVEGVNTTEEVSWYKGK 52 >At3g55750.1 68416.m06194 60S ribosomal protein L35a (RPL35aD) ribosomal protein L35a.e.c15, Saccharomyces cerevisiae, PIR:S44069 Length = 111 Score = 74.5 bits (175), Expect = 4e-14 Identities = 36/67 (53%), Positives = 45/67 (67%) Frame = +2 Query: 251 LLYVYRAKKRTPIPGGPRGKKTKLRAIWGKVTRPHGNSGSVRAKFKSNLPAQAMGHRIRV 430 L Y+Y+AK + + R IWGKVTRPHGNSG VR+KF SNLP ++MG R+RV Sbjct: 53 LAYIYKAKTKK--------NGSHYRCIWGKVTRPHGNSGVVRSKFTSNLPPKSMGARVRV 104 Query: 431 MLYPSRI 451 +YPS I Sbjct: 105 FMYPSNI 111 Score = 43.2 bits (97), Expect = 1e-04 Identities = 17/42 (40%), Positives = 26/42 (61%) Frame = +3 Query: 123 RLYAKAVFTGYKRGLRNQHENTALLKVEGAKDRNDAVFYAGK 248 RLY + GYKR NQ+ NT+L+++EG + + +Y GK Sbjct: 10 RLYVRGTVLGYKRSKSNQYPNTSLVQIEGVNTQEEVNWYKGK 51 >At1g41880.1 68414.m04836 60S ribosomal protein L35a (RPL35aB) identical to GB:CAB81600 from [Arabidopsis thaliana] Length = 111 Score = 74.5 bits (175), Expect = 4e-14 Identities = 36/67 (53%), Positives = 45/67 (67%) Frame = +2 Query: 251 LLYVYRAKKRTPIPGGPRGKKTKLRAIWGKVTRPHGNSGSVRAKFKSNLPAQAMGHRIRV 430 L Y+Y+AK + + R IWGKVTRPHGNSG VR+KF SNLP ++MG R+RV Sbjct: 53 LAYIYKAKTKK--------NGSHYRCIWGKVTRPHGNSGVVRSKFTSNLPPKSMGARVRV 104 Query: 431 MLYPSRI 451 +YPS I Sbjct: 105 FMYPSNI 111 Score = 43.6 bits (98), Expect = 8e-05 Identities = 17/42 (40%), Positives = 26/42 (61%) Frame = +3 Query: 123 RLYAKAVFTGYKRGLRNQHENTALLKVEGAKDRNDAVFYAGK 248 RLY + GYKR NQ+ NT+L+++EG + + +Y GK Sbjct: 10 RLYVRGTVLGYKRSKSNQYPNTSLIQIEGVNTQEEVNWYKGK 51 >At5g45160.1 68418.m05544 root hair defective 3 GTP-binding (RHD3) family protein contains Pfam profile: PF05879 root hair defective 3 GTP-binding protein (RHD3) family Length = 834 Score = 29.5 bits (63), Expect = 1.4 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = +2 Query: 251 LLYVYRAKKRTPIPGGPRGKKTKLRAIWGKVTRPHGNSGSVRAKF 385 LL+V R K +TPI R + ++ IW V +P + + +F Sbjct: 166 LLFVIRDKTKTPIELLERALREDIQKIWDSVRKPEAHKNTPLNEF 210 >At5g44620.1 68418.m05467 cytochrome P450 family protein similar to cytocrhome P450 monooxygenase (GI:14334057) [Gossypium arboreum] Length = 519 Score = 27.5 bits (58), Expect = 5.7 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +2 Query: 230 SLLCWQALLYVYRAKKRTPIPGGPRG 307 S LCW LY ++ P+P GP G Sbjct: 27 STLCWCLWLYAKCKRRSPPLPPGPWG 52 >At5g17920.1 68418.m02101 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase / vitamin-B12-independent methionine synthase / cobalamin-independent methionine synthase (CIMS) identical to SP|O50008 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase (EC 2.1.1.14) (Vitamin-B12-independent methionine synthase isozyme) (Cobalamin-independent methionine synthase isozyme) {Arabidopsis thaliana} Length = 765 Score = 27.5 bits (58), Expect = 5.7 Identities = 26/92 (28%), Positives = 36/92 (39%) Frame = +3 Query: 129 YAKAVFTGYKRGLRNQHENTALLKVEGAKDRNDAVFYAGKHCSMCTELRRGHQFPEVPVA 308 Y KA+ K+ + Q E + V G +RND V Y G+ S G Sbjct: 463 YVKAIKEEIKKVVDLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRC 522 Query: 309 KKPSCVLSGAR*PAHMATLAVSEPSSSLTSLP 404 KP + P M T+ S + S+TS P Sbjct: 523 VKPPVIYGDVSRPKAM-TVFWSAMAQSMTSRP 553 >At4g21130.1 68417.m03055 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); some similarity to a group of proteins with homology to mammalian apoptosis regulators identified in zebrafish (PUBMED:10917738)Apaf-1(gi:7677507) Length = 537 Score = 27.5 bits (58), Expect = 5.7 Identities = 18/57 (31%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Frame = -3 Query: 433 HHSYSVS-HSLGREVRLELGSDTARVAMWAGHLAPDSTQLGFFATGTSGNWCPLLSS 266 H S +S +LGRE L +G D G + P+ST+L + A+ ++ C ++S Sbjct: 304 HQSELLSIDALGRERVLSVGRDRTMQLYKVGIVVPESTRLIYRASESNFECCCFVNS 360 >At3g05180.1 68416.m00565 GDSL-motif lipase/hydrolase family protein similar to early nodulin ENOD8 [Medicago sativa] GI:304037, elicitor-induced glycoprotein iEP4 [Daucus carota] GI:1911765, lanatoside 15'-O-acetylesterase [Digitalis lanata] GI:3688284; contains InterPro Entry IPR001087 Lipolytic enzyme, G-D-S-L family Length = 379 Score = 27.5 bits (58), Expect = 5.7 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -3 Query: 376 SDTARVAMWAGHLAPDSTQLGFFATGTSGNWC 281 SDT ++ G L S ++ FF + TSG +C Sbjct: 45 SDTGELSSGLGFLPQPSYEITFFRSPTSGRFC 76 >At5g51195.1 68418.m06348 hypothetical protein Length = 267 Score = 27.1 bits (57), Expect = 7.5 Identities = 13/39 (33%), Positives = 18/39 (46%) Frame = -3 Query: 397 EVRLELGSDTARVAMWAGHLAPDSTQLGFFATGTSGNWC 281 E++ E+ S+ W D T FFA+ SG WC Sbjct: 209 EIQAEMESEDVAATFWID----DETHDDFFASSKSGWWC 243 >At2g04350.2 68415.m00434 long-chain-fatty-acid--CoA ligase family protein / long-chain acyl-CoA synthetase family protein (LACS8) similar to LACS 4 [SP|O35547] from Rattus norvegicus, LACS 4 [SP|O60488] from Homo sapiens; contains Pfam HMM hit: AMP-binding enzymes PF00501 Length = 720 Score = 26.6 bits (56), Expect = 9.9 Identities = 15/41 (36%), Positives = 20/41 (48%) Frame = -1 Query: 459 GS*ILEGYSITRILCPIAWAGRLDLNLARTLPELPCGRVTL 337 GS I +GY +T ++ D + R P LPCG V L Sbjct: 469 GSPIGQGYGLTETCAGATFSEWDDPAVGRVGPPLPCGYVKL 509 >At2g04350.1 68415.m00433 long-chain-fatty-acid--CoA ligase family protein / long-chain acyl-CoA synthetase family protein (LACS8) similar to LACS 4 [SP|O35547] from Rattus norvegicus, LACS 4 [SP|O60488] from Homo sapiens; contains Pfam HMM hit: AMP-binding enzymes PF00501 Length = 720 Score = 26.6 bits (56), Expect = 9.9 Identities = 15/41 (36%), Positives = 20/41 (48%) Frame = -1 Query: 459 GS*ILEGYSITRILCPIAWAGRLDLNLARTLPELPCGRVTL 337 GS I +GY +T ++ D + R P LPCG V L Sbjct: 469 GSPIGQGYGLTETCAGATFSEWDDPAVGRVGPPLPCGYVKL 509 >At1g20130.1 68414.m02518 family II extracellular lipase, putative contains Pfam profile PF00657: GDSL-like Lipase/Acylhydrolase; similar to EXL3 (PMID:11431566) Length = 1006 Score = 26.6 bits (56), Expect = 9.9 Identities = 15/52 (28%), Positives = 20/52 (38%) Frame = +2 Query: 275 KRTPIPGGPRGKKTKLRAIWGKVTRPHGNSGSVRAKFKSNLPAQAMGHRIRV 430 K P P P K +G GN+ ++ K KSN M + RV Sbjct: 132 KPAPSPPKPENKTIPAVFFFGDSVFDTGNNNNLETKIKSNYRPYGMDFKFRV 183 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,612,162 Number of Sequences: 28952 Number of extensions: 229453 Number of successful extensions: 654 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 622 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 654 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 937669760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -