BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1082 (644 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q4SB68 Cluster: Chromosome undetermined SCAF14677, whol... 34 2.6 UniRef50_Q4SB67 Cluster: Chromosome undetermined SCAF14677, whol... 34 2.6 UniRef50_A1XDB3 Cluster: STIP; n=1; Bombyx mori|Rep: STIP - Bomb... 33 7.8 >UniRef50_Q4SB68 Cluster: Chromosome undetermined SCAF14677, whole genome shotgun sequence; n=1; Tetraodon nigroviridis|Rep: Chromosome undetermined SCAF14677, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 333 Score = 34.3 bits (75), Expect = 2.6 Identities = 18/60 (30%), Positives = 30/60 (50%) Frame = +3 Query: 39 PPTLRCKF*DLSIVTTAAHPSNRNALLLHSRNRQGGGTYPRGLTRGPTTSSPNIVTFKIE 218 PPT KF + + T A P + N + HS G++P G + G SP++V +++ Sbjct: 42 PPTFTGKFCHIPVTMTPATPPSTNDIASHSEFLMPLGSHPEGASAG--APSPSMVKVRVQ 99 >UniRef50_Q4SB67 Cluster: Chromosome undetermined SCAF14677, whole genome shotgun sequence; n=1; Tetraodon nigroviridis|Rep: Chromosome undetermined SCAF14677, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 781 Score = 34.3 bits (75), Expect = 2.6 Identities = 18/60 (30%), Positives = 30/60 (50%) Frame = +3 Query: 39 PPTLRCKF*DLSIVTTAAHPSNRNALLLHSRNRQGGGTYPRGLTRGPTTSSPNIVTFKIE 218 PPT KF + + T A P + N + HS G++P G + G SP++V +++ Sbjct: 22 PPTFTGKFCHIPVTMTPATPPSTNDIASHSEFLMPLGSHPEGASAG--APSPSMVKVRVQ 79 Score = 33.5 bits (73), Expect = 4.5 Identities = 18/60 (30%), Positives = 30/60 (50%) Frame = +3 Query: 39 PPTLRCKF*DLSIVTTAAHPSNRNALLLHSRNRQGGGTYPRGLTRGPTTSSPNIVTFKIE 218 PPT KF + + T A P + N + HS G++P G + G SP++V +++ Sbjct: 545 PPTFTGKFCHIPVTMTPATPPSTNDIASHSEFLMPLGSHPGGASAG--APSPSMVKVRVQ 602 >UniRef50_A1XDB3 Cluster: STIP; n=1; Bombyx mori|Rep: STIP - Bombyx mori (Silk moth) Length = 782 Score = 32.7 bits (71), Expect = 7.8 Identities = 14/19 (73%), Positives = 15/19 (78%), Gaps = 1/19 (5%) Frame = +2 Query: 149 YLPARTHKRSYHQ*S-EYC 202 YLPARTHKRSYH+ YC Sbjct: 573 YLPARTHKRSYHRYQCSYC 591 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 577,923,027 Number of Sequences: 1657284 Number of extensions: 10755130 Number of successful extensions: 19420 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 18877 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19411 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 48541014171 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -