Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= br--1082
         (644 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein.          23   8.3  
AY462096-1|AAS21248.1|  603|Anopheles gambiae transposase protein.     23   8.3  

>CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein.
          Length = 1494

 Score = 23.0 bits (47), Expect = 8.3
 Identities = 10/32 (31%), Positives = 16/32 (50%)
 Frame = +1

Query: 100  QTETHYCFTAEIDRAAVPTRADSQEVLPPVVR 195
            Q ET  C+T+  +       ++ QEV P  V+
Sbjct: 1179 QNETLSCYTSRRNSTTSNANSEPQEVAPQFVK 1210


>AY462096-1|AAS21248.1|  603|Anopheles gambiae transposase protein.
          Length = 603

 Score = 23.0 bits (47), Expect = 8.3
 Identities = 8/10 (80%), Positives = 9/10 (90%)
 Frame = -1

Query: 617 SSTSLNFCHI 588
           +ST LNFCHI
Sbjct: 255 ASTELNFCHI 264


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 637,905
Number of Sequences: 2352
Number of extensions: 12305
Number of successful extensions: 15
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 14
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 15
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 63559560
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)