BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1082 (644 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g21210.1 68417.m03066 expressed protein contains Pfam domain ... 29 3.5 At4g01930.1 68417.m00257 DC1 domain-containing protein contains ... 27 8.1 >At4g21210.1 68417.m03066 expressed protein contains Pfam domain PF03618: Domain of unknown function (DUF299) Length = 403 Score = 28.7 bits (61), Expect = 3.5 Identities = 17/34 (50%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = +3 Query: 147 GTYPRGLTRGPTTSSPNIVTFK-IEELHFIGKYN 245 GT P GL+RG T SS N FK IE + F K++ Sbjct: 219 GTNPSGLSRGITNSSLNEDYFKRIEAIEFTIKHD 252 >At4g01930.1 68417.m00257 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 652 Score = 27.5 bits (58), Expect = 8.1 Identities = 11/39 (28%), Positives = 22/39 (56%), Gaps = 3/39 (7%) Frame = +3 Query: 492 CHVCELNLKKI---CIMCNINVTFIDVAYAPHLVTNVTK 599 C++C +++K + C +CN NV Y P V ++++ Sbjct: 81 CNLCGISIKSLFYNCEICNFNVHMYCAKYPPPQVIDISE 119 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,545,239 Number of Sequences: 28952 Number of extensions: 237400 Number of successful extensions: 363 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 355 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 363 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1334473344 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -