BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1077 (637 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly pro... 23 2.5 L01589-1|AAA27736.1| 81|Apis mellifera zinc finger protein pro... 22 5.7 >AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly protein 8 protein. Length = 416 Score = 23.0 bits (47), Expect = 2.5 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +1 Query: 139 QGVLPPPSEVVENGLKIVTEYKY 207 QGV S + N LK++ E+KY Sbjct: 15 QGVTDIHSRNLTNSLKVIYEWKY 37 >L01589-1|AAA27736.1| 81|Apis mellifera zinc finger protein protein. Length = 81 Score = 21.8 bits (44), Expect = 5.7 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = -2 Query: 330 QACRWLNLQICSKFYVWQYSLKQHVFNFVCP 238 QA + + + C K YV +LK H+ P Sbjct: 12 QAKKSFSCKYCEKVYVSLGALKMHIRTHTLP 42 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 163,239 Number of Sequences: 438 Number of extensions: 3044 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19071468 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -