BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1074 (629 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q6LEY8 Cluster: Putative uncharacterized protein; n=1; ... 33 5.7 UniRef50_Q8WRD2 Cluster: Cysteine repeat modular protein 1 PbCRM... 33 7.5 UniRef50_Q4Z2N1 Cluster: Putative uncharacterized protein; n=5; ... 33 7.5 UniRef50_A0C5G8 Cluster: Chromosome undetermined scaffold_15, wh... 33 7.5 UniRef50_A0RW82 Cluster: Putative uncharacterized protein; n=2; ... 33 7.5 >UniRef50_Q6LEY8 Cluster: Putative uncharacterized protein; n=1; Plasmodium falciparum 3D7|Rep: Putative uncharacterized protein - Plasmodium falciparum (isolate 3D7) Length = 573 Score = 33.1 bits (72), Expect = 5.7 Identities = 19/56 (33%), Positives = 33/56 (58%), Gaps = 7/56 (12%) Frame = +2 Query: 464 IQLKN*LYFCNNFFL-TDILNLIL------VYLNWICNFYMSFYCNNQDSYLPKLC 610 I L N YF NN F + N+I+ + L++I FY+ ++ +NQ+ Y+P++C Sbjct: 461 IYLNNKAYFMNNAFCYLNNENIIMSNEMLNIDLDYILLFYILYFNDNQNLYIPRVC 516 >UniRef50_Q8WRD2 Cluster: Cysteine repeat modular protein 1 PbCRM1; n=10; Plasmodium (Vinckeia)|Rep: Cysteine repeat modular protein 1 PbCRM1 - Plasmodium berghei Length = 3087 Score = 32.7 bits (71), Expect = 7.5 Identities = 19/52 (36%), Positives = 28/52 (53%) Frame = -1 Query: 584 DYYNKMTYRNYISN*DTQVLSSECLLKKNYYKNTTSFSTGSYLNLFLVMVII 429 D YNKMT N +++S +CLL+ YY N T + Y +LF ++ I Sbjct: 2295 DVYNKMTNILTSENQKKKIISIDCLLR--YYFNLTYNDSFFYTSLFFFLIPI 2344 >UniRef50_Q4Z2N1 Cluster: Putative uncharacterized protein; n=5; Plasmodium (Vinckeia)|Rep: Putative uncharacterized protein - Plasmodium berghei Length = 1538 Score = 32.7 bits (71), Expect = 7.5 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 7/50 (14%) Frame = -1 Query: 581 YYNKMTYRNYIS-------N*DTQVLSSECLLKKNYYKNTTSFSTGSYLN 453 Y+NK ++NYIS + + + LS+ECL Y N + + ++LN Sbjct: 916 YFNKFVFKNYISYLILLSNDEEIKYLSNECLFISGYKDNNSDYHQSTHLN 965 >UniRef50_A0C5G8 Cluster: Chromosome undetermined scaffold_15, whole genome shotgun sequence; n=2; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_15, whole genome shotgun sequence - Paramecium tetraurelia Length = 1752 Score = 32.7 bits (71), Expect = 7.5 Identities = 12/49 (24%), Positives = 27/49 (55%) Frame = +2 Query: 482 LYFCNNFFLTDILNLILVYLNWICNFYMSFYCNNQDSYLPKLCVSVVDT 628 LYF N +++ L++++L ++ F +FY +L K C+ ++ + Sbjct: 207 LYFQNRSAFNNVVQLLMMHLYYLSQFINAFYVGTFPPHLSKFCLILISS 255 >UniRef50_A0RW82 Cluster: Putative uncharacterized protein; n=2; Thermoprotei|Rep: Putative uncharacterized protein - Cenarchaeum symbiosum Length = 125 Score = 32.7 bits (71), Expect = 7.5 Identities = 19/45 (42%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = +1 Query: 100 VSYIRT**FMSNIRTTSDQREREIERVHMKLIIRFIY-GHGSRAN 231 VSY+R N+R D++E E VH + +RF Y GHG R N Sbjct: 57 VSYLRHNAVFINVRKIPDEKELEKTIVHELIHMRFQYLGHGRRFN 101 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 494,193,950 Number of Sequences: 1657284 Number of extensions: 8153933 Number of successful extensions: 16680 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 16196 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16655 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 46466611856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -