BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1074 (629 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 24 1.1 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 23 2.4 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 23 2.4 DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholi... 22 5.7 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 24.2 bits (50), Expect = 1.1 Identities = 14/52 (26%), Positives = 25/52 (48%), Gaps = 1/52 (1%) Frame = -1 Query: 491 KNTTSFSTGSYLNLFLVMVII*KEVQNNRQYYLRV*NTYLFDVT-NLCTKEC 339 K + GS++ ++ VI +E + + Y TYLFD+ N ++C Sbjct: 511 KTMKTIKKGSFVTQYVGEVITNEEAEKRGKEYDAAGRTYLFDLDYNESEEQC 562 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 23.0 bits (47), Expect = 2.4 Identities = 11/34 (32%), Positives = 16/34 (47%) Frame = -1 Query: 590 YPDYYNKMTYRNYISN*DTQVLSSECLLKKNYYK 489 YP YY MTY N + + S+ + K Y + Sbjct: 292 YPGYYPTMTYSNGLPFPQRPIWSNFPIYKYKYIR 325 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 23.0 bits (47), Expect = 2.4 Identities = 11/34 (32%), Positives = 16/34 (47%) Frame = -1 Query: 590 YPDYYNKMTYRNYISN*DTQVLSSECLLKKNYYK 489 YP YY MTY N + + S+ + K Y + Sbjct: 292 YPGYYPTMTYSNGLPFPQRPIWSNFPIYKYKYIR 325 >DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholine receptor beta2subunit protein. Length = 427 Score = 21.8 bits (44), Expect = 5.7 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +3 Query: 528 YLCISIGYVISICHFI 575 +LCIS+ Y+I + FI Sbjct: 402 FLCISLVYIIMLIIFI 417 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 154,501 Number of Sequences: 438 Number of extensions: 3258 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18826962 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -