BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1073X (454 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY745212-1|AAU93479.1| 104|Anopheles gambiae cytochrome P450 pr... 25 0.94 AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. 24 2.2 DQ974165-1|ABJ52805.1| 482|Anopheles gambiae serpin 5 protein. 23 6.7 DQ004399-1|AAY21238.1| 847|Anopheles gambiae lysozyme c-6 protein. 22 8.8 AY705403-1|AAU12512.1| 520|Anopheles gambiae nicotinic acetylch... 22 8.8 AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical prote... 22 8.8 AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical prote... 22 8.8 AF164152-1|AAD47076.1| 261|Anopheles gambiae ribosomal protein ... 22 8.8 >AY745212-1|AAU93479.1| 104|Anopheles gambiae cytochrome P450 protein. Length = 104 Score = 25.4 bits (53), Expect = 0.94 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = +3 Query: 177 PDVRGRDADVLVPDPEAGRQAQAVLGLNMG 266 PD G D D +P+ GR A +MG Sbjct: 52 PDAEGFDPDRFLPERSQGRHPHAYAPFSMG 81 >AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. Length = 1133 Score = 24.2 bits (50), Expect = 2.2 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +1 Query: 370 LYTYNTLNGLMFLVNLCFLIECMSV 444 L T++ NG F+ + +IEC +V Sbjct: 46 LRTFDLNNGFRFIASAAIVIECQAV 70 >DQ974165-1|ABJ52805.1| 482|Anopheles gambiae serpin 5 protein. Length = 482 Score = 22.6 bits (46), Expect = 6.7 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +3 Query: 186 RGRDADVLVPDPEAGRQ 236 RGR ++L+ DP+ G Q Sbjct: 236 RGRIGEILLDDPDPGTQ 252 >DQ004399-1|AAY21238.1| 847|Anopheles gambiae lysozyme c-6 protein. Length = 847 Score = 22.2 bits (45), Expect = 8.8 Identities = 13/44 (29%), Positives = 19/44 (43%) Frame = +3 Query: 174 RPDVRGRDADVLVPDPEAGRQAQAVLGLNMGRPNTPPRAQPKNK 305 +P RG+ A ++ E G A RP PP+ P+ K Sbjct: 612 QPYCRGKSATMIDGCFEEGENAIVPTPPTTRRPIAPPKNFPRGK 655 >AY705403-1|AAU12512.1| 520|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 8 protein. Length = 520 Score = 22.2 bits (45), Expect = 8.8 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -2 Query: 135 EECDELPLRKELVSILDDLVRAT 67 ++ E+PLRK + D+VR T Sbjct: 496 QQLSEIPLRKNNFMLPPDIVRIT 518 >AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 22.2 bits (45), Expect = 8.8 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -1 Query: 280 GVLGRPMLSPSTACA 236 GVL RPM P+ CA Sbjct: 210 GVLVRPMHPPNVTCA 224 >AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 22.2 bits (45), Expect = 8.8 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -1 Query: 280 GVLGRPMLSPSTACA 236 GVL RPM P+ CA Sbjct: 210 GVLVRPMHPPNVTCA 224 >AF164152-1|AAD47076.1| 261|Anopheles gambiae ribosomal protein L8 protein. Length = 261 Score = 22.2 bits (45), Expect = 8.8 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = +3 Query: 297 KNKKN*WPHTRAVRRHTHGHP 359 K K+N WP R V + HP Sbjct: 190 KVKRNCWPKVRGVAMNPVEHP 210 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 488,276 Number of Sequences: 2352 Number of extensions: 10079 Number of successful extensions: 27 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 38694201 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -