BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1070 (658 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_4413| Best HMM Match : No HMM Matches (HMM E-Value=.) 171 4e-43 SB_53557| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_42238| Best HMM Match : Trypsin (HMM E-Value=0) 32 0.36 SB_23120| Best HMM Match : Mucin (HMM E-Value=0.033) 30 1.4 SB_53780| Best HMM Match : RVT_1 (HMM E-Value=0.0007) 29 2.5 SB_22198| Best HMM Match : Borrelia_orfA (HMM E-Value=5.4) 29 2.5 SB_20635| Best HMM Match : rve (HMM E-Value=0.91) 29 3.3 SB_5251| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_54962| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_52533| Best HMM Match : rve (HMM E-Value=2) 29 3.3 SB_25521| Best HMM Match : NLPC_P60 (HMM E-Value=5.7) 29 3.3 SB_993| Best HMM Match : rve (HMM E-Value=2.7e-33) 29 3.3 SB_32523| Best HMM Match : 7tm_1 (HMM E-Value=1.4e-17) 28 5.8 SB_32282| Best HMM Match : Laminin_G_2 (HMM E-Value=0) 28 5.8 SB_51875| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 SB_11562| Best HMM Match : SelP_N (HMM E-Value=0.45) 28 7.7 SB_8063| Best HMM Match : Homeobox (HMM E-Value=8.5e-24) 28 7.7 >SB_4413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 171 bits (416), Expect = 4e-43 Identities = 82/98 (83%), Positives = 90/98 (91%), Gaps = 1/98 (1%) Frame = +2 Query: 218 QTREHLLVF-FTNQEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNG 394 +T EH+ +F +EFEIIDFFLG +L DEVLKIMPVQKQTRAGQRTRFKAFVAIGD+NG Sbjct: 24 KTLEHIYLFSLPIKEFEIIDFFLGAALKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDSNG 83 Query: 395 HIGLGVKCSKEVATAIRGAIILAKLSVLPVRRGYWGNK 508 H+GLGVKCSKEVATAIRGAIILAKLSV+PVRRGYWGNK Sbjct: 84 HVGLGVKCSKEVATAIRGAIILAKLSVIPVRRGYWGNK 121 Score = 104 bits (250), Expect = 6e-23 Identities = 45/53 (84%), Positives = 49/53 (92%) Frame = +1 Query: 499 G*QVGKPHTVPCKVTGKCGSVTVRLIPDPRGTGIVSAPVPKKLLQMAGVQDCY 657 G ++GKPHTVPCKVTGKCGS VRLIP PRGTGIVSAPVPKKLLQMAG++DCY Sbjct: 119 GNKIGKPHTVPCKVTGKCGSTRVRLIPAPRGTGIVSAPVPKKLLQMAGIEDCY 171 Score = 52.0 bits (119), Expect = 4e-07 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = +3 Query: 168 WVPVTKLGRLVREGKIDKLESIYLFSLPIK 257 WVPVTKLGRLV++ KI LE IYLFSLPIK Sbjct: 8 WVPVTKLGRLVKDLKIKTLEHIYLFSLPIK 37 >SB_53557| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1049 Score = 32.3 bits (70), Expect = 0.36 Identities = 20/66 (30%), Positives = 32/66 (48%) Frame = -1 Query: 469 QLSKDNSASNGSGDFLAALHTQTNMTVVVANGNKCLETCALSGTCLFLYRHDLKNLIIQG 290 ++ + NS N D TNMT + + G CL + TC+ L DL NL+ + Sbjct: 235 RILRRNSQPNDQADVARLQSLITNMTEIYSTGKVCL-NITRNNTCMSL-DPDLGNLMSRS 292 Query: 289 RAEEEI 272 R ++E+ Sbjct: 293 RNQDEL 298 >SB_42238| Best HMM Match : Trypsin (HMM E-Value=0) Length = 657 Score = 32.3 bits (70), Expect = 0.36 Identities = 20/66 (30%), Positives = 32/66 (48%) Frame = -1 Query: 469 QLSKDNSASNGSGDFLAALHTQTNMTVVVANGNKCLETCALSGTCLFLYRHDLKNLIIQG 290 ++ + NS N D TNMT + + G CL + TC+ L DL NL+ + Sbjct: 519 RILRRNSQPNDQADVARLQSLITNMTEIYSTGKVCL-NITRNNTCMSL-DPDLGNLMSRS 576 Query: 289 RAEEEI 272 R ++E+ Sbjct: 577 RNQDEL 582 >SB_23120| Best HMM Match : Mucin (HMM E-Value=0.033) Length = 382 Score = 30.3 bits (65), Expect = 1.4 Identities = 14/37 (37%), Positives = 17/37 (45%) Frame = -2 Query: 192 GRVW*QEPTLSGLPCRAHDHGRDHDRVHEDRHGLYLH 82 G +W + L LP H DHDR H RH +H Sbjct: 103 GFLWQKNGVLLSLPPPQFRHSHDHDRHHYHRHHNNIH 139 >SB_53780| Best HMM Match : RVT_1 (HMM E-Value=0.0007) Length = 280 Score = 29.5 bits (63), Expect = 2.5 Identities = 19/44 (43%), Positives = 23/44 (52%) Frame = -1 Query: 442 NGSGDFLAALHTQTNMTVVVANGNKCLETCALSGTCLFLYRHDL 311 N G LA + N+ +V NG K + C LS T L LY HDL Sbjct: 108 NAYGKSLAEFYNSNNL--IVLNGVK--QGCMLSPTLLNLYVHDL 147 >SB_22198| Best HMM Match : Borrelia_orfA (HMM E-Value=5.4) Length = 394 Score = 29.5 bits (63), Expect = 2.5 Identities = 17/50 (34%), Positives = 26/50 (52%) Frame = -2 Query: 651 ILYTSHLKKLLRNWRRHNTSTTRIRNQPDCYGTTLAGDLARDGVWLSYLL 502 +LYT + + RN++ +NT T + Q + TT+ L D LS LL Sbjct: 238 LLYTRNSTRTARNYQYYNTRET-LHGQRETINTTIHAKLYTDSEKLSILL 286 Score = 28.3 bits (60), Expect = 5.8 Identities = 17/50 (34%), Positives = 26/50 (52%) Frame = -2 Query: 651 ILYTSHLKKLLRNWRRHNTSTTRIRNQPDCYGTTLAGDLARDGVWLSYLL 502 +LYT + + RN++ +NT T R Q + TT+ L D LS L+ Sbjct: 36 LLYTRNSTRTARNYQYYNTRQTLCR-QRETINTTIHAKLYTDSEKLSILV 84 Score = 28.3 bits (60), Expect = 5.8 Identities = 17/50 (34%), Positives = 26/50 (52%) Frame = -2 Query: 651 ILYTSHLKKLLRNWRRHNTSTTRIRNQPDCYGTTLAGDLARDGVWLSYLL 502 +LYT + + RN++ +NT T R Q + TT+ L D LS L+ Sbjct: 285 LLYTRNSTRTARNYQYYNTRQTLCR-QRETINTTIHAKLYTDSEKLSILV 333 >SB_20635| Best HMM Match : rve (HMM E-Value=0.91) Length = 748 Score = 29.1 bits (62), Expect = 3.3 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +2 Query: 296 NDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLG 409 N +LK++ + Q +A + F+ FVA + H G G Sbjct: 155 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 192 >SB_5251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 945 Score = 29.1 bits (62), Expect = 3.3 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +2 Query: 296 NDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLG 409 N +LK++ + Q +A + F+ FVA + H G G Sbjct: 811 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 848 >SB_54962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2211 Score = 29.1 bits (62), Expect = 3.3 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +2 Query: 296 NDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLG 409 N +LK++ + Q +A + F+ FVA + H G G Sbjct: 2008 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 2045 >SB_52533| Best HMM Match : rve (HMM E-Value=2) Length = 212 Score = 29.1 bits (62), Expect = 3.3 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +2 Query: 296 NDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLG 409 N +LK++ + Q +A + F+ FVA + H G G Sbjct: 95 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 132 >SB_25521| Best HMM Match : NLPC_P60 (HMM E-Value=5.7) Length = 212 Score = 29.1 bits (62), Expect = 3.3 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +2 Query: 296 NDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLG 409 N +LK++ + Q +A + F+ FVA + H G G Sbjct: 9 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 46 >SB_993| Best HMM Match : rve (HMM E-Value=2.7e-33) Length = 735 Score = 29.1 bits (62), Expect = 3.3 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +2 Query: 296 NDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLG 409 N +LK++ + Q +A + F+ FVA + H G G Sbjct: 532 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 569 >SB_32523| Best HMM Match : 7tm_1 (HMM E-Value=1.4e-17) Length = 1130 Score = 28.3 bits (60), Expect = 5.8 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 346 TAHTFQGICCHWRQQRSYW 402 TA + ICCH +Q + +W Sbjct: 486 TADQYDAICCHTQQSKKFW 504 >SB_32282| Best HMM Match : Laminin_G_2 (HMM E-Value=0) Length = 897 Score = 28.3 bits (60), Expect = 5.8 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = +2 Query: 344 GQRTRFKAFVAIGDNNGHIGLGVKCSKEVA 433 G++ + K F+A+G NGH+ C ++A Sbjct: 356 GRKDKRKDFLALGLRNGHVEFRFSCGADIA 385 >SB_51875| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 27.9 bits (59), Expect = 7.7 Identities = 15/48 (31%), Positives = 18/48 (37%) Frame = -3 Query: 653 QSCTPAI*RSFLGTGADTIPVPRGSGISRTVTEPHLPVTLQGTVCGFP 510 +SC PA + G G D G + TEPH QG P Sbjct: 144 RSCGPAFGDPWFGCGRDLFIADNAGGNKASCTEPHKYARPQGATSDGP 191 >SB_11562| Best HMM Match : SelP_N (HMM E-Value=0.45) Length = 453 Score = 27.9 bits (59), Expect = 7.7 Identities = 14/45 (31%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = -2 Query: 141 HDHGRDHDRVHEDRHGLYLHR-VIRNRRENRHVHRLEQRPPLLND 10 H H R H H H + HR R+R + H H +R D Sbjct: 312 HHHHRHHHHHHHHHHQRHRHRHRHRHRHHHHHHHEYNRRHRYFTD 356 >SB_8063| Best HMM Match : Homeobox (HMM E-Value=8.5e-24) Length = 963 Score = 27.9 bits (59), Expect = 7.7 Identities = 15/44 (34%), Positives = 25/44 (56%) Frame = -2 Query: 471 DSLARIIAPRMAVATSLLHFTPKPI*PLLSPMATNALKRVRCPA 340 D+L+ IAP A SLL + P+++P A +AL ++ P+ Sbjct: 365 DALSLQIAPSANNALSLLKGAYDALSPMIAPSANDALSLLKAPS 408 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,261,510 Number of Sequences: 59808 Number of extensions: 469750 Number of successful extensions: 1405 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 1236 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1402 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1681430875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -