BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1067 (642 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_0345 - 28142434-28142658,28143087-28143158,28143252-281433... 91 7e-19 02_02_0707 + 13144147-13144788,13145115-13148663 29 2.4 10_08_0444 + 17971724-17971797,17972119-17972176,17972613-179727... 29 4.1 07_03_1591 + 27967065-27967090,27967236-27968054,27984940-279850... 28 7.2 >02_05_0345 - 28142434-28142658,28143087-28143158,28143252-28143371, 28143483-28143674,28144919-28145017,28145448-28145594, 28146310-28146513 Length = 352 Score = 91.1 bits (216), Expect = 7e-19 Identities = 37/79 (46%), Positives = 54/79 (68%) Frame = +2 Query: 263 KIGTHDGVFHCDEVLACFMLKNLPQYKDAEIIRTRDLNKLNDCDIVVDVGSVFDHEKKRY 442 ++GTH+G FHCDE L C++++ Q+ A+++RTRD L+ D V+DVG V+D + RY Sbjct: 31 RVGTHNGSFHCDEALGCYLIRLTSQFAGADVVRTRDPQILDTLDAVLDVGGVYDPSRHRY 90 Query: 443 DHHQAGFNETLSP*GLNSE 499 DHHQ GFNE G N++ Sbjct: 91 DHHQKGFNEVFGH-GFNTK 108 Score = 34.7 bits (76), Expect = 0.063 Identities = 20/44 (45%), Positives = 30/44 (68%), Gaps = 1/44 (2%) Frame = +3 Query: 513 KLSSAGLVYAYYGEDIIQQLKEESTSLTNEDL-K*FTRSYESFI 641 KLSSAGLVY ++G++II KE S +ED+ + + Y+SF+ Sbjct: 108 KLSSAGLVYKHFGKEII--AKELEVSEDHEDVHRLYLAIYKSFV 149 >02_02_0707 + 13144147-13144788,13145115-13148663 Length = 1396 Score = 29.5 bits (63), Expect = 2.4 Identities = 12/46 (26%), Positives = 26/46 (56%) Frame = +3 Query: 105 TLNNEFYNLIKYNVTYRNITYVMLNRILPRTCSLLNSASYNFRHYC 242 TLNN ++ + + +IT+++ + ++P C+L+ A + H C Sbjct: 992 TLNNRDRIVLLWQGVFEHITHIVQSTVMP--CNLVEKAVFGLLHIC 1035 >10_08_0444 + 17971724-17971797,17972119-17972176,17972613-17972708, 17972974-17973000,17973019-17973075,17973604-17973687, 17974304-17974384,17974928-17975071,17975218-17975309, 17975998-17976079,17976818-17977000,17977360-17977438, 17977555-17977613,17978162-17978290,17979188-17979367, 17980312-17980446,17980528-17980602,17980890-17980947, 17981035-17981282,17981594-17981733,17981961-17982132, 17982797-17982887,17983099-17983221,17984951-17985032, 17985715-17985835,17985886-17985915,17986427-17986549 Length = 940 Score = 28.7 bits (61), Expect = 4.1 Identities = 16/61 (26%), Positives = 28/61 (45%), Gaps = 1/61 (1%) Frame = +2 Query: 284 VFHCDEVLACF-MLKNLPQYKDAEIIRTRDLNKLNDCDIVVDVGSVFDHEKKRYDHHQAG 460 + H + V +C +L + K A + D N+L++C ++ GS + Y HQ Sbjct: 597 LMHNEVVTSCSNLLAGMEILKAAMVQLLNDYNRLSECVKIIPGGSTLNRNLPYYGVHQVH 656 Query: 461 F 463 F Sbjct: 657 F 657 >07_03_1591 + 27967065-27967090,27967236-27968054,27984940-27985022, 27985590-27985744,27985956-27986461,27986551-27986703, 27987146-27987485,27987558-27987822,27987897-27988634, 27989734-27989779,27989849-27990223,27991511-27991567, 27991640-27992438 Length = 1453 Score = 27.9 bits (59), Expect = 7.2 Identities = 23/62 (37%), Positives = 34/62 (54%) Frame = +2 Query: 269 GTHDGVFHCDEVLACFMLKNLPQYKDAEIIRTRDLNKLNDCDIVVDVGSVFDHEKKRYDH 448 G+H+GV V AC M N P+ KD R +KL + ++V VG VFD ++ YD Sbjct: 334 GSHEGVDRPPCVQACEM--NTPE-KDRVY---RHDSKLRE-EMVPKVGMVFDSYEEAYDF 386 Query: 449 HQ 454 ++ Sbjct: 387 YE 388 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,164,370 Number of Sequences: 37544 Number of extensions: 255105 Number of successful extensions: 505 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 494 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 505 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1584867848 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -