BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1066 (649 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 23 2.5 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 23 3.4 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 23.0 bits (47), Expect = 2.5 Identities = 13/32 (40%), Positives = 17/32 (53%), Gaps = 2/32 (6%) Frame = +3 Query: 186 PFFEQLPAKFPRAVFLKVDVDRCP--IQRVLR 275 PF E+L FPR L V P +Q++LR Sbjct: 141 PFHEKLVESFPRGGSLPTPVTPTPTTVQQLLR 172 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 22.6 bits (46), Expect = 3.4 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = +3 Query: 312 TGPKSTD*KEAILLY*KTKLDQYYGS 389 T P+S KE ILL+ K L+QY+ S Sbjct: 57 TEPRS---KEEILLHAKDFLEQYFSS 79 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 160,282 Number of Sequences: 438 Number of extensions: 3122 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19560480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -