BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1065 (608 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC4G3.19 |alp16||gamma tubulin complex subunit Alp16 |Schizosa... 30 0.23 >SPCC4G3.19 |alp16||gamma tubulin complex subunit Alp16 |Schizosaccharomyces pombe|chr 3|||Manual Length = 759 Score = 30.3 bits (65), Expect = 0.23 Identities = 17/57 (29%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Frame = -2 Query: 529 IYQPCMTNLSM*YTSTYETVKH-YSIVEFD*FIVSSIAFDNKDISDNYLSKLSSNKL 362 I +P + + STY+ +K+ + + + F S+ F N + SDN +S L S +L Sbjct: 499 IAEPIQSFILSFLRSTYKVLKNDFQVFDLLNFFHSTFLFQNYEFSDNVISLLKSRRL 555 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,377,238 Number of Sequences: 5004 Number of extensions: 45458 Number of successful extensions: 96 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 93 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 96 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 268287866 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -