BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1065 (608 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 23 2.3 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 23 2.3 AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 23 2.3 AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-act... 21 9.4 AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 21 9.4 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 21 9.4 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 23.0 bits (47), Expect = 2.3 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = +1 Query: 100 PPAPSGPDSSK 132 PP+ SGPDS+K Sbjct: 347 PPSSSGPDSAK 357 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 23.0 bits (47), Expect = 2.3 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -2 Query: 436 IVSSIAFDNKDISDNYLSKLSSNKLAV 356 +VS FD K +SD + KLS + +V Sbjct: 209 VVSDPIFDKKAMSDLVICKLSHSNASV 235 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 23.0 bits (47), Expect = 2.3 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -2 Query: 436 IVSSIAFDNKDISDNYLSKLSSNKLAV 356 +VS FD K +SD + KLS + +V Sbjct: 209 VVSDPIFDKKAMSDLVICKLSHSNASV 235 >AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-activated ion channelvariant T protein. Length = 288 Score = 21.0 bits (42), Expect = 9.4 Identities = 13/53 (24%), Positives = 23/53 (43%) Frame = -2 Query: 469 KHYSIVEFD*FIVSSIAFDNKDISDNYLSKLSSNKLAVHSXNLVHVKHLFRLI 311 KHY F ++SSI D + N S + +H+ + + L +L+ Sbjct: 162 KHYLRTWFFLDLISSIPLDYIFLIFNQFQDFSESFQILHAGRALRILRLAKLL 214 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 21.0 bits (42), Expect = 9.4 Identities = 13/53 (24%), Positives = 23/53 (43%) Frame = -2 Query: 469 KHYSIVEFD*FIVSSIAFDNKDISDNYLSKLSSNKLAVHSXNLVHVKHLFRLI 311 KHY F ++SSI D + N S + +H+ + + L +L+ Sbjct: 162 KHYLRTWFFLDLISSIPLDYIFLIFNQFQDFSESFQILHAGRALRILRLAKLL 214 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 21.0 bits (42), Expect = 9.4 Identities = 13/53 (24%), Positives = 23/53 (43%) Frame = -2 Query: 469 KHYSIVEFD*FIVSSIAFDNKDISDNYLSKLSSNKLAVHSXNLVHVKHLFRLI 311 KHY F ++SSI D + N S + +H+ + + L +L+ Sbjct: 162 KHYLRTWFFLDLISSIPLDYIFLIFNQFQDFSESFQILHAGRALRILRLAKLL 214 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 168,427 Number of Sequences: 438 Number of extensions: 3539 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17971191 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -