BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1063 (645 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory recept... 27 0.13 AM292339-1|CAL23151.2| 387|Tribolium castaneum gustatory recept... 25 0.40 AM292338-1|CAL23150.2| 372|Tribolium castaneum gustatory recept... 25 0.40 >AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory receptor candidate 40 protein. Length = 373 Score = 27.1 bits (57), Expect = 0.13 Identities = 13/37 (35%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = +2 Query: 443 GLQHFYD-YYHYRFSWSYYNIINDRNLNTSFFDPAGG 550 G++HF+ +HY F++ YNI+ L T P G Sbjct: 178 GVEHFFKKQFHYIFTYMPYNIVFGLCLTTFGLLPVNG 214 >AM292339-1|CAL23151.2| 387|Tribolium castaneum gustatory receptor candidate 18 protein. Length = 387 Score = 25.4 bits (53), Expect = 0.40 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +1 Query: 196 PLPYIINFKKNCRKWCRN 249 PLP +++ KNC +C N Sbjct: 272 PLPIVLSIVKNCLSYCFN 289 >AM292338-1|CAL23150.2| 372|Tribolium castaneum gustatory receptor candidate 17 protein. Length = 372 Score = 25.4 bits (53), Expect = 0.40 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +1 Query: 196 PLPYIINFKKNCRKWCRN 249 PLP +++ KNC +C N Sbjct: 272 PLPIVLSIVKNCLSYCFN 289 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 116,903 Number of Sequences: 336 Number of extensions: 2209 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16552695 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -