BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1062 (533 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. 22 3.0 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 5.2 AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 21 5.2 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 6.8 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 6.8 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 6.8 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 6.8 AF265300-1|AAG17643.1| 126|Tribolium castaneum putative cytochr... 21 6.8 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 21 9.0 >AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. Length = 247 Score = 22.2 bits (45), Expect = 3.0 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = +2 Query: 35 VGNVMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFA 145 VG + EG L E +GD G+L AS +FA Sbjct: 91 VGTALTFCLQEEGGTTSQLIELLGDAGKLL-ASVHFA 126 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.4 bits (43), Expect = 5.2 Identities = 5/11 (45%), Positives = 7/11 (63%) Frame = +1 Query: 133 WKLRHCDWTQS 165 W HCDW ++ Sbjct: 2271 WNKDHCDWPEN 2281 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 21.4 bits (43), Expect = 5.2 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = -3 Query: 213 TFLAPDGSFTLVR 175 T PDG FT++R Sbjct: 579 TVTVPDGGFTIIR 591 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.0 bits (42), Expect = 6.8 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -2 Query: 391 DGYHHREDALQGSWQHHVHMASS 323 D Y HR ++LQ +++V SS Sbjct: 1532 DNYDHRRNSLQMQQRNNVTWKSS 1554 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.0 bits (42), Expect = 6.8 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -2 Query: 391 DGYHHREDALQGSWQHHVHMASS 323 D Y HR ++LQ +++V SS Sbjct: 1532 DNYDHRRNSLQMQQRNNVTWKSS 1554 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.0 bits (42), Expect = 6.8 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -2 Query: 391 DGYHHREDALQGSWQHHVHMASS 323 D Y HR ++LQ +++V SS Sbjct: 1532 DNYDHRRNSLQMQQRNNVTWKSS 1554 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.0 bits (42), Expect = 6.8 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -2 Query: 391 DGYHHREDALQGSWQHHVHMASS 323 D Y HR ++LQ +++V SS Sbjct: 1532 DNYDHRRNSLQMQQRNNVTWKSS 1554 >AF265300-1|AAG17643.1| 126|Tribolium castaneum putative cytochrome P450 monooxigenase protein. Length = 126 Score = 21.0 bits (42), Expect = 6.8 Identities = 9/31 (29%), Positives = 12/31 (38%) Frame = -3 Query: 519 INLGSFFVSVLPPQSSGPASSNKTNFATSRC 427 + +G F V P P + NF RC Sbjct: 88 VGIGQFLVHRNPKYFPNPDKFDPDNFLPERC 118 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 20.6 bits (41), Expect = 9.0 Identities = 8/24 (33%), Positives = 11/24 (45%) Frame = -2 Query: 82 HNGTLRHSSNRHHISNFKSCFLST 11 H L H+ HH+ S F S+ Sbjct: 343 HQAMLHHNPMSHHLKQEPSGFTSS 366 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 138,377 Number of Sequences: 336 Number of extensions: 3066 Number of successful extensions: 9 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12992348 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -