BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1062 (533 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride... 23 1.5 DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride... 23 1.5 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 23 1.5 DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride... 23 1.5 AF441189-1|AAL73401.1| 134|Apis mellifera ribosomal protein 49 ... 22 3.4 DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 22 4.5 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 22 4.5 DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 21 7.9 DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 21 7.9 >DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride channel variant 4 protein. Length = 489 Score = 23.4 bits (48), Expect = 1.5 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -2 Query: 103 HFLFKIAHNGTLRHSSNRHHI 41 HF +I NGT+ + RH I Sbjct: 163 HFALRIYRNGTVNYLMRRHLI 183 >DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride channel variant 3 protein. Length = 475 Score = 23.4 bits (48), Expect = 1.5 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -2 Query: 103 HFLFKIAHNGTLRHSSNRHHI 41 HF +I NGT+ + RH I Sbjct: 163 HFALRIYRNGTVNYLMRRHLI 183 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 23.4 bits (48), Expect = 1.5 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -2 Query: 103 HFLFKIAHNGTLRHSSNRHHI 41 HF +I NGT+ + RH I Sbjct: 214 HFALRIYRNGTVNYLMRRHLI 234 >DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride channel protein. Length = 458 Score = 23.4 bits (48), Expect = 1.5 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -2 Query: 103 HFLFKIAHNGTLRHSSNRHHI 41 HF +I NGT+ + RH I Sbjct: 163 HFALRIYRNGTVNYLMRRHLI 183 >AF441189-1|AAL73401.1| 134|Apis mellifera ribosomal protein 49 protein. Length = 134 Score = 22.2 bits (45), Expect = 3.4 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +2 Query: 152 IGHNPDAKRTRVKLPSGAKKVL 217 IG+ + K+TR LP+G +KVL Sbjct: 57 IGYGSN-KKTRHMLPTGFRKVL 77 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 21.8 bits (44), Expect = 4.5 Identities = 11/44 (25%), Positives = 19/44 (43%) Frame = -3 Query: 528 DLIINLGSFFVSVLPPQSSGPASSNKTNFATSRCSSLDSGSLTY 397 DL+ + + PP+ G A+ + S+D S+TY Sbjct: 39 DLLPEDPKLYDKMRPPKKDGQATVVYFHVTVMGLDSIDENSMTY 82 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.8 bits (44), Expect = 4.5 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = -1 Query: 311 LYLWYALPAFKIGLSIRPPQQQYRP 237 L L +A PA+ G P QQQ P Sbjct: 1263 LMLQHAPPAYSCGTVSVPQQQQLPP 1287 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 21.0 bits (42), Expect = 7.9 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = -3 Query: 411 GSLTYMLMVTTTVRMLYRVH 352 GS+TY + TTT+ + +H Sbjct: 147 GSVTYGMRFTTTLACMMDLH 166 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 21.0 bits (42), Expect = 7.9 Identities = 5/14 (35%), Positives = 10/14 (71%) Frame = +3 Query: 309 QGQT*LLAICTWCC 350 +G+ +++ C WCC Sbjct: 3 KGRHVVMSCCCWCC 16 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 164,643 Number of Sequences: 438 Number of extensions: 3666 Number of successful extensions: 11 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15090993 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -