BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1061 (429 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_02_0548 - 10467342-10468810,10470309-10471632 28 2.8 01_06_0414 + 29182350-29183812,29184211-29184346 28 3.7 03_05_0353 + 23410354-23410485,23410678-23411089,23411304-23411332 27 4.9 11_06_0395 + 23088737-23088823,23090198-23090346,23090570-230907... 27 6.4 05_03_0356 + 12894195-12894237,12894347-12894484,12894868-128950... 27 8.5 04_04_0903 - 29269794-29270141,29270227-29270751 27 8.5 >09_02_0548 - 10467342-10468810,10470309-10471632 Length = 930 Score = 28.3 bits (60), Expect = 2.8 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = -2 Query: 242 HGRNRQGGVTYPCEL 198 H RN+ GV YPCEL Sbjct: 896 HERNKYAGVAYPCEL 910 >01_06_0414 + 29182350-29183812,29184211-29184346 Length = 532 Score = 27.9 bits (59), Expect = 3.7 Identities = 14/37 (37%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Frame = -2 Query: 173 YANYNFAGLIF-IT*CYSFTVEVNIERLLSTYFIEKF 66 +A N+ G I +T YSF VE+ I+ ++ YF ++F Sbjct: 250 HALTNYRGWILALTYGYSFGVELTIDNVVHQYFYDRF 286 >03_05_0353 + 23410354-23410485,23410678-23411089,23411304-23411332 Length = 190 Score = 27.5 bits (58), Expect = 4.9 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +3 Query: 270 WSSRCNYTETLELISQGGWRIYVVDVYGLQ 359 WS Y++T EL+ + GW+ + VD G+Q Sbjct: 72 WSIGVAYSDTGELVLRSGWKEF-VDANGVQ 100 >11_06_0395 + 23088737-23088823,23090198-23090346,23090570-23090708, 23090795-23090889,23090967-23091080,23091674-23091803, 23091931-23092052,23092889-23093007,23093946-23094034, 23094072-23094245,23094310-23094616,23094726-23095180, 23095334-23096315,23096381-23097396,23097757-23097792, 23098065-23098130 Length = 1359 Score = 27.1 bits (57), Expect = 6.4 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -1 Query: 60 CLRFEHRWIAQHECTGRHI 4 CLR E QH+CT RH+ Sbjct: 751 CLRLESSGYMQHKCTVRHL 769 >05_03_0356 + 12894195-12894237,12894347-12894484,12894868-12895018, 12895399-12895526,12895704-12895840,12896742-12896847, 12898659-12898762,12899159-12899281,12899620-12899700, 12900159-12900304,12902171-12902243,12902970-12903060, 12904978-12905018,12906079-12906153,12906402-12906569, 12907638-12907676,12907759-12907847,12908014-12908078, 12908794-12908840,12908924-12908983,12909168-12909239, 12910143-12910172,12910526-12910617,12910719-12910802, 12911941-12912046,12912171-12912233,12912776-12912870, 12913000-12913180 Length = 875 Score = 26.6 bits (56), Expect = 8.5 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = -2 Query: 263 KPKALLLHGRNRQGGVTYPCELTRGPTTSNYANYNF 156 K K LL GR+ + GV Y C P T + + F Sbjct: 412 KDKLLLQEGRDVRWGVHYNCRQKVTPATEGFGAFMF 447 >04_04_0903 - 29269794-29270141,29270227-29270751 Length = 290 Score = 26.6 bits (56), Expect = 8.5 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -2 Query: 242 HGRNRQGGVTYPCEL 198 HGR+R+ GVTYP L Sbjct: 54 HGRHRRTGVTYPVSL 68 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,363,132 Number of Sequences: 37544 Number of extensions: 252505 Number of successful extensions: 556 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 547 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 555 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 802495716 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -