BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1061 (429 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 23 1.1 DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 22 3.3 AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase prot... 21 4.4 AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase pro... 21 5.8 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 23.4 bits (48), Expect = 1.1 Identities = 19/59 (32%), Positives = 25/59 (42%) Frame = -2 Query: 356 EPIDIYNVNAPPTLRYKFQGLSIVTTAAPPFKPKALLLHGRNRQGGVTYPCELTRGPTT 180 EP+ N + P R S T+++PP K A R GG T EL R +T Sbjct: 502 EPVVETNSSPSPNPRIA-SAPSSSTSSSPPAKGAAAAGQPSKRNGGETNKQELKRLKST 559 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 21.8 bits (44), Expect = 3.3 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = -1 Query: 87 YVFHRKIRTCLRFEHRWIA 31 Y+FH I TCL W++ Sbjct: 247 YLFHTYIPTCLIVIMSWVS 265 >AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase protein. Length = 693 Score = 21.4 bits (43), Expect = 4.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -2 Query: 293 SIVTTAAPPFKPKALLLHGRNRQ 225 S+V + PF+P +L NRQ Sbjct: 277 SLVASRTWPFRPSGTVLKDINRQ 299 >AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase protein. Length = 588 Score = 21.0 bits (42), Expect = 5.8 Identities = 9/31 (29%), Positives = 16/31 (51%) Frame = +3 Query: 72 FYEIRTQQTFNIDFHSEGITSCNKNQTRKII 164 +YE+ + FN F ++ +S Q + II Sbjct: 310 YYEVGSNVPFNFKFITDANSSSTPEQFKVII 340 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 131,889 Number of Sequences: 438 Number of extensions: 2792 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 11121030 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -