BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1060 (642 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ969955-1|CAI94742.1| 160|Tribolium castaneum torso-like prote... 23 1.6 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 23 2.8 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 23 2.8 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 23 2.8 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 23 2.8 AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. 22 4.9 AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neu... 21 8.6 AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase ... 21 8.6 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 21 8.6 AF265298-1|AAG17641.1| 124|Tribolium castaneum putative cytochr... 21 8.6 >AJ969955-1|CAI94742.1| 160|Tribolium castaneum torso-like protein protein. Length = 160 Score = 23.4 bits (48), Expect = 1.6 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -2 Query: 632 VLGNAIYSYRTGTQRIYSRLEIRNKLRCLSH 540 V GNA+Y + IY +++ R K + +SH Sbjct: 99 VTGNALYQVFVFRRSIYLQIKERLKTQGISH 129 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 22.6 bits (46), Expect = 2.8 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +1 Query: 43 TVDEMPGSLHPLEERHRYPQQIP 111 T+DE +H R R P++IP Sbjct: 643 TIDEAASDVHQTHMRIRPPKKIP 665 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 22.6 bits (46), Expect = 2.8 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +1 Query: 43 TVDEMPGSLHPLEERHRYPQQIP 111 T+DE +H R R P++IP Sbjct: 643 TIDEAASDVHQTHMRIRPPKKIP 665 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 22.6 bits (46), Expect = 2.8 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +1 Query: 43 TVDEMPGSLHPLEERHRYPQQIP 111 T+DE +H R R P++IP Sbjct: 643 TIDEAASDVHQTHMRIRPPKKIP 665 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 22.6 bits (46), Expect = 2.8 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +1 Query: 43 TVDEMPGSLHPLEERHRYPQQIP 111 T+DE +H R R P++IP Sbjct: 643 TIDEAASDVHQTHMRIRPPKKIP 665 >AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. Length = 247 Score = 21.8 bits (44), Expect = 4.9 Identities = 8/12 (66%), Positives = 11/12 (91%) Frame = +3 Query: 147 KTFTNSLTGSPV 182 KTF ++LTG+PV Sbjct: 141 KTFKSTLTGTPV 152 >AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neuroblasts defectiveprotein protein. Length = 224 Score = 21.0 bits (42), Expect = 8.6 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = -1 Query: 252 CCLARCSCLHRVRDL*SSC 196 CCL CS R + SSC Sbjct: 191 CCLRTCSSAKRPKFENSSC 209 >AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase protein. Length = 268 Score = 21.0 bits (42), Expect = 8.6 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +1 Query: 298 GFRYLRNGTAGVHTK 342 GFRYL N H+K Sbjct: 134 GFRYLVNDELSAHSK 148 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 21.0 bits (42), Expect = 8.6 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +1 Query: 298 GFRYLRNGTAGVHTK 342 GFRYL N H+K Sbjct: 448 GFRYLVNDELSAHSK 462 >AF265298-1|AAG17641.1| 124|Tribolium castaneum putative cytochrome P450 monooxigenase protein. Length = 124 Score = 21.0 bits (42), Expect = 8.6 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -1 Query: 153 TFLKSFPQNLYHNEWY 106 TFL F ++HNE Y Sbjct: 83 TFLSLFIYGMHHNEKY 98 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,260 Number of Sequences: 336 Number of extensions: 3235 Number of successful extensions: 12 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16448590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -