BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1060 (642 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_41941| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_6560| Best HMM Match : F-box (HMM E-Value=2e-10) 38 0.009 SB_20853| Best HMM Match : F-box (HMM E-Value=1.1e-05) 32 0.34 SB_10275| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.46 SB_22037| Best HMM Match : Xan_ur_permease (HMM E-Value=2e-07) 31 0.60 SB_43342| Best HMM Match : F-box (HMM E-Value=4.1e-09) 26 1.4 SB_40708| Best HMM Match : SRCR (HMM E-Value=0) 30 1.4 SB_50216| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_49878| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_22456| Best HMM Match : LRR_1 (HMM E-Value=1.4e-11) 29 3.2 SB_26957| Best HMM Match : PDZ (HMM E-Value=0) 29 3.2 SB_43064| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_26992| Best HMM Match : rve (HMM E-Value=6.3e-36) 29 4.2 SB_55795| Best HMM Match : 7tm_1 (HMM E-Value=3.9e-08) 29 4.2 SB_38076| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-05) 29 4.2 SB_7037| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_52387| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_7673| Best HMM Match : DUF805 (HMM E-Value=2.3) 28 5.6 SB_34912| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_42988| Best HMM Match : Pox_D3 (HMM E-Value=2.2) 27 9.8 SB_41663| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.8 SB_22599| Best HMM Match : UME (HMM E-Value=4.4) 27 9.8 SB_17170| Best HMM Match : RVT_1 (HMM E-Value=0.0023) 27 9.8 SB_16966| Best HMM Match : DUF598 (HMM E-Value=0.00017) 27 9.8 SB_11511| Best HMM Match : RVT_1 (HMM E-Value=0.79) 27 9.8 SB_493| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.8 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.8 SB_41650| Best HMM Match : RVT_1 (HMM E-Value=1.6e-06) 27 9.8 SB_38417| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.8 SB_34372| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.8 SB_27013| Best HMM Match : UME (HMM E-Value=4.4) 27 9.8 SB_20271| Best HMM Match : UME (HMM E-Value=8.1) 27 9.8 SB_17450| Best HMM Match : RVT_1 (HMM E-Value=2.2e-25) 27 9.8 SB_4015| Best HMM Match : F-box (HMM E-Value=5.9e-11) 27 9.8 >SB_41941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 254 Score = 39.1 bits (87), Expect = 0.003 Identities = 24/76 (31%), Positives = 38/76 (50%) Frame = +2 Query: 2 TEILSHIFTFLPAKQLTKCREVCIRWKNVIDTLNKYHSLWYKFCGKDFKNVYKFAHRLSR 181 TEIL IF+ L A+ + + C R + L LW + C +D Y+ A Sbjct: 26 TEILLFIFSLLDARSIVRASRACTR---LHFALKYCDPLWRRLCRRD----YELALSFRA 78 Query: 182 PQITWHELYRSLTLWR 229 P T++++YRSL++ R Sbjct: 79 PFDTYYDIYRSLSMSR 94 >SB_6560| Best HMM Match : F-box (HMM E-Value=2e-10) Length = 216 Score = 37.5 bits (83), Expect = 0.009 Identities = 23/72 (31%), Positives = 37/72 (51%) Frame = +2 Query: 2 TEILSHIFTFLPAKQLTKCREVCIRWKNVIDTLNKYHSLWYKFCGKDFKNVYKFAHRLSR 181 T++L HIF+ L A+ L C +VC +W V + + L ++ C K +N+ L R Sbjct: 6 TDVLLHIFSHLDAQSLCSCSQVCKQWYEVSTISSLWKMLVFQQCRK--RNI---RPHLGR 60 Query: 182 PQITWHELYRSL 217 + TW E + L Sbjct: 61 AE-TWKERFFQL 71 >SB_20853| Best HMM Match : F-box (HMM E-Value=1.1e-05) Length = 637 Score = 32.3 bits (70), Expect = 0.34 Identities = 18/71 (25%), Positives = 35/71 (49%) Frame = +2 Query: 5 EILSHIFTFLPAKQLTKCREVCIRWKNVIDTLNKYHSLWYKFCGKDFKNVYKFAHRLSRP 184 EIL IF + A LTK VC +W ++++K SLW + + +++ + Sbjct: 7 EILLQIFRYFDAFILTKICSVCKQW----NSISKTPSLWRRLVLRRWQSQRFLFANVPPS 62 Query: 185 QITWHELYRSL 217 + W ++Y+ + Sbjct: 63 SVNWRKVYQEI 73 >SB_10275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 947 Score = 31.9 bits (69), Expect = 0.46 Identities = 23/65 (35%), Positives = 31/65 (47%) Frame = +2 Query: 2 TEILSHIFTFLPAKQLTKCREVCIRWKNVIDTLNKYHSLWYKFCGKDFKNVYKFAHRLSR 181 +E+LS I ++LPAK L E C R+K + + +LW C K F A R R Sbjct: 21 SEVLSIILSYLPAKTLLNLSETCRRFKELCFECD---TLWKDLC-KQFS-----ASRDLR 71 Query: 182 PQITW 196 P W Sbjct: 72 PSKIW 76 >SB_22037| Best HMM Match : Xan_ur_permease (HMM E-Value=2e-07) Length = 445 Score = 31.5 bits (68), Expect = 0.60 Identities = 21/59 (35%), Positives = 27/59 (45%) Frame = -3 Query: 301 SPGFRWPPWLLTRIRRVLSSEVQLPPQSQRPVELVPSDLRTGEPVSEFVNVFKVLSAKL 125 SP FR PWL R + + Q P S +PV PS + G P VF +L+ L Sbjct: 77 SPVFRLFPWLYGRQSGKVLNARQFPIYSNKPVNCQPS--QWGTPTVSAAGVFGMLAGVL 133 >SB_43342| Best HMM Match : F-box (HMM E-Value=4.1e-09) Length = 456 Score = 26.2 bits (55), Expect(2) = 1.4 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 8 ILSHIFTFLPAKQLTKCREVCIRW 79 ++ IF++L L K EVC RW Sbjct: 53 VILKIFSYLSRADLLKAAEVCKRW 76 Score = 22.6 bits (46), Expect(2) = 1.4 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +2 Query: 194 WHELYRSLTLWRQLHL 241 WHEL +LWR + L Sbjct: 76 WHELSFDRSLWRNVDL 91 >SB_40708| Best HMM Match : SRCR (HMM E-Value=0) Length = 1976 Score = 30.3 bits (65), Expect = 1.4 Identities = 20/58 (34%), Positives = 29/58 (50%) Frame = +3 Query: 354 VL*FGHATANKRAVIYGDYNRYVETDDTVLLMNSNLHLFITRKLIRSPKHIAVFLMII 527 +L FG+ATA A +G DD + S L LF R++I SP ++ +II Sbjct: 674 MLNFGNATAYHTAGYFGRGTGDTWLDDLECTVVSALSLFSRRRVISSPSVFRIYPIII 731 >SB_50216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3293 Score = 29.5 bits (63), Expect = 2.4 Identities = 25/121 (20%), Positives = 49/121 (40%), Gaps = 1/121 (0%) Frame = +2 Query: 227 RQLHLAR-QHSTNSRQQPRWPAKSRASDIYETERPASTLKPAWCIMIWTRYSEQTRSYLR 403 R+ +L+R + + R S SD + A +KPAW + + EQ Sbjct: 1231 REEYLSRVMNESRKRFADEHKRHSFHSDYMSRNKEAVLVKPAWSSSRSSLHDEQRSPPEE 1290 Query: 404 RLQPLCRNRRHSTPDE*QSTFVHNKKTNT*PQAHSSISHDNCKLFYVIDNVVYYVSLNES 583 + + L +R S +E + +F +T+ + +S +N + F + + +S Sbjct: 1291 QRESLNEEKRRSFQEENRRSFQEENRTSFEEENGTSFQEENRRSFQEENRTSFQKEKRDS 1350 Query: 584 I 586 I Sbjct: 1351 I 1351 >SB_49878| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 283 Score = 29.1 bits (62), Expect = 3.2 Identities = 19/76 (25%), Positives = 33/76 (43%) Frame = -3 Query: 376 VACPNHNTPRRL*CGRRPFRFVNI*SPGFRWPPWLLTRIRRVLSSEVQLPPQSQRPVELV 197 ++CP H+ P + G + + NI PG P + ++ + P S V Sbjct: 105 ISCPGHSVPSIMSTGEQKAKGGNISCPGHSVPSMMSKGEQKAKGGNILCPGHS------V 158 Query: 196 PSDLRTGEPVSEFVNV 149 PS + TGE ++ N+ Sbjct: 159 PSMMNTGEQKAKGGNI 174 Score = 28.7 bits (61), Expect = 4.2 Identities = 19/76 (25%), Positives = 32/76 (42%) Frame = -3 Query: 376 VACPNHNTPRRL*CGRRPFRFVNI*SPGFRWPPWLLTRIRRVLSSEVQLPPQSQRPVELV 197 + CP H+ P + G + + NI PG P + T ++ + P S V Sbjct: 82 ILCPGHSVPSMMSTGEQKAKGGNISCPGHSVPSIMSTGEQKAKGGNISCPGHS------V 135 Query: 196 PSDLRTGEPVSEFVNV 149 PS + GE ++ N+ Sbjct: 136 PSMMSKGEQKAKGGNI 151 Score = 27.5 bits (58), Expect = 9.8 Identities = 19/76 (25%), Positives = 33/76 (43%) Frame = -3 Query: 376 VACPNHNTPRRL*CGRRPFRFVNI*SPGFRWPPWLLTRIRRVLSSEVQLPPQSQRPVELV 197 ++ P H+ P + G + + NI PG P + T ++ + P S V Sbjct: 59 ISSPCHSVPSMMSTGEQKAKGGNILCPGHSVPSMMSTGEQKAKGGNISCPGHS------V 112 Query: 196 PSDLRTGEPVSEFVNV 149 PS + TGE ++ N+ Sbjct: 113 PSIMSTGEQKAKGGNI 128 >SB_22456| Best HMM Match : LRR_1 (HMM E-Value=1.4e-11) Length = 459 Score = 29.1 bits (62), Expect = 3.2 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +2 Query: 5 EILSHIFTFLPAKQLTKCREVCIRWKNVID 94 E++S+IF+FLP + VC W D Sbjct: 22 EVVSYIFSFLPLADIKSSARVCHLWAKASD 51 >SB_26957| Best HMM Match : PDZ (HMM E-Value=0) Length = 1685 Score = 29.1 bits (62), Expect = 3.2 Identities = 21/51 (41%), Positives = 26/51 (50%), Gaps = 3/51 (5%) Frame = +2 Query: 50 TKCREVCIRWKNVID--TLNKYHSLWYKFCGKDFK-NVYKFAHRLSRPQIT 193 T+CREV I V +L KYH LW F GK K + K + RP +T Sbjct: 31 TRCREVGITLFTVSHRKSLWKYHELWPLFSGKLVKPHPSKLFYIPQRPYMT 81 >SB_43064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 975 Score = 28.7 bits (61), Expect = 4.2 Identities = 11/45 (24%), Positives = 23/45 (51%) Frame = +2 Query: 137 KDFKNVYKFAHRLSRPQITWHELYRSLTLWRQLHLARQHSTNSRQ 271 +DF+++ + + + L +WR++HL R+H SR+ Sbjct: 394 EDFEDITLYCKYYCLLDVGKQQRVGQLVVWREVHLTRRHKKESRK 438 >SB_26992| Best HMM Match : rve (HMM E-Value=6.3e-36) Length = 1022 Score = 28.7 bits (61), Expect = 4.2 Identities = 18/79 (22%), Positives = 34/79 (43%) Frame = +2 Query: 284 PAKSRASDIYETERPASTLKPAWCIMIWTRYSEQTRSYLRRLQPLCRNRRHSTPDE*QST 463 P R + E P+ + C+ +++ YS+ +Y R++P+ + P+ + Sbjct: 491 PDPERLRPLRELPVPSDSKSLNRCLGLFSYYSQWIPAYSDRIKPITSCKVFPLPEPAVAA 550 Query: 464 FVHNKKTNT*PQAHSSISH 520 F KKT H S+ H Sbjct: 551 FESIKKTVEEAFLHESLCH 569 >SB_55795| Best HMM Match : 7tm_1 (HMM E-Value=3.9e-08) Length = 363 Score = 28.7 bits (61), Expect = 4.2 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = +3 Query: 75 AGRTSSIPSTNTIHCGISFAERTLKTFTNSLT 170 +G TS P+TNTI + E TL N LT Sbjct: 2 SGTTSGKPNTNTIAIAVFLGEGTLAAVANVLT 33 >SB_38076| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-05) Length = 577 Score = 28.7 bits (61), Expect = 4.2 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = +3 Query: 75 AGRTSSIPSTNTIHCGISFAERTLKTFTNSLT 170 +G TS P+TNTI + E TL N LT Sbjct: 2 SGTTSGKPNTNTIAIAVFLGEGTLAAVANVLT 33 >SB_7037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 28.7 bits (61), Expect = 4.2 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = +3 Query: 75 AGRTSSIPSTNTIHCGISFAERTLKTFTNSLT 170 +G TS P+TNTI + E TL N LT Sbjct: 2 SGTTSGKPNTNTIAIAVFLGEGTLAAVANVLT 33 >SB_52387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1088 Score = 28.3 bits (60), Expect = 5.6 Identities = 13/33 (39%), Positives = 21/33 (63%), Gaps = 2/33 (6%) Frame = +2 Query: 5 EILSHIFTFLPA--KQLTKCREVCIRWKNVIDT 97 E+++HIF+F +L R VC +WK +ID+ Sbjct: 7 EMIAHIFSFFHQIYGKLLLLRTVCRKWKIIIDS 39 >SB_7673| Best HMM Match : DUF805 (HMM E-Value=2.3) Length = 100 Score = 28.3 bits (60), Expect = 5.6 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = +3 Query: 75 AGRTSSIPSTNTIHCGISFAERTLKTFTNSLT 170 +G TS P+TNTI + E TL N LT Sbjct: 2 SGTTSGKPNTNTIAIAVFLGEGTLGAVANVLT 33 >SB_34912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 554 Score = 27.9 bits (59), Expect = 7.4 Identities = 16/66 (24%), Positives = 31/66 (46%) Frame = +2 Query: 38 AKQLTKCREVCIRWKNVIDTLNKYHSLWYKFCGKDFKNVYKFAHRLSRPQITWHELYRSL 217 A+ KC ++ W+++I + Y+S CG +Y+ ++RP +++ R L Sbjct: 276 ARPYYKCTKLLQMWRDLITNVPSYYS-----CGATLLQMYQVITDVARP---YYKCTRLL 327 Query: 218 TLWRQL 235 W L Sbjct: 328 QFWHDL 333 >SB_42988| Best HMM Match : Pox_D3 (HMM E-Value=2.2) Length = 336 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/40 (32%), Positives = 21/40 (52%), Gaps = 3/40 (7%) Frame = -3 Query: 565 VINYVVYHIKQFTI---IMRNTAMCLGLRISFLVMNKCRL 455 ++ Y+V I++F + N C +R+SFL N C L Sbjct: 32 IMRYIVSDIQEFASNNNMQLNPTKCKEMRVSFLHYNSCEL 71 >SB_41663| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 27.5 bits (58), Expect = 9.8 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +2 Query: 5 EILSHIFTFLPAKQLTKCREVCIRW 79 EIL+ IF++L K L + +VC W Sbjct: 118 EILNKIFSYLNPKDLCRTSQVCKSW 142 >SB_22599| Best HMM Match : UME (HMM E-Value=4.4) Length = 199 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/40 (32%), Positives = 21/40 (52%), Gaps = 3/40 (7%) Frame = -3 Query: 565 VINYVVYHIKQFTI---IMRNTAMCLGLRISFLVMNKCRL 455 ++ Y+V I++F + N C +R+SFL N C L Sbjct: 32 IMRYIVSDIQEFASNNNMQLNPTKCKEMRVSFLHYNSCEL 71 >SB_17170| Best HMM Match : RVT_1 (HMM E-Value=0.0023) Length = 391 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/40 (32%), Positives = 21/40 (52%), Gaps = 3/40 (7%) Frame = -3 Query: 565 VINYVVYHIKQFTI---IMRNTAMCLGLRISFLVMNKCRL 455 ++ Y+V I++F + N C +R+SFL N C L Sbjct: 159 IMRYIVSDIQEFASNNNMQLNPTKCKEMRVSFLHYNSCEL 198 >SB_16966| Best HMM Match : DUF598 (HMM E-Value=0.00017) Length = 377 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/40 (32%), Positives = 21/40 (52%), Gaps = 3/40 (7%) Frame = -3 Query: 565 VINYVVYHIKQFTI---IMRNTAMCLGLRISFLVMNKCRL 455 ++ Y+V I++F + N C +R+SFL N C L Sbjct: 130 IMRYIVSDIQEFASNNNMQLNPTKCKEMRVSFLHYNSCEL 169 >SB_11511| Best HMM Match : RVT_1 (HMM E-Value=0.79) Length = 289 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/40 (32%), Positives = 21/40 (52%), Gaps = 3/40 (7%) Frame = -3 Query: 565 VINYVVYHIKQFTI---IMRNTAMCLGLRISFLVMNKCRL 455 ++ Y+V I++F + N C +R+SFL N C L Sbjct: 122 IMRYIVSDIQEFASNNNMQLNPTKCKEMRVSFLHYNSCEL 161 >SB_493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 27.5 bits (58), Expect = 9.8 Identities = 14/46 (30%), Positives = 25/46 (54%) Frame = +2 Query: 455 QSTFVHNKKTNT*PQAHSSISHDNCKLFYVIDNVVYYVSLNESIYA 592 Q+ + K TN P A SSI N Y+++N V +++L + ++ Sbjct: 33 QAKMLFRKLTNHSP-ARSSIESGNMMFHYILENSVCFLTLTDKPFS 77 >SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1584 Score = 27.5 bits (58), Expect = 9.8 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = +3 Query: 51 RNAGKFASAGRTSSIPSTNTIHCGISFAERTLKTFTNSLTGS 176 RN G G S P TN++ G+S LK++T S T + Sbjct: 162 RNHGN-TFTGYPRSYPRTNSVLAGVSSPGDALKSYTQSYTNN 202 >SB_41650| Best HMM Match : RVT_1 (HMM E-Value=1.6e-06) Length = 299 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/40 (32%), Positives = 21/40 (52%), Gaps = 3/40 (7%) Frame = -3 Query: 565 VINYVVYHIKQFTI---IMRNTAMCLGLRISFLVMNKCRL 455 ++ Y+V I++F + N C +R+SFL N C L Sbjct: 184 IMRYIVSDIQEFASNNNMQLNPTKCKEMRVSFLHYNSCEL 223 >SB_38417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1019 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/40 (32%), Positives = 21/40 (52%), Gaps = 3/40 (7%) Frame = -3 Query: 565 VINYVVYHIKQFTI---IMRNTAMCLGLRISFLVMNKCRL 455 ++ Y+V I++F + N C +R+SFL N C L Sbjct: 794 IMRYIVSDIQEFASNNNMQLNPTKCKEMRVSFLHYNSCEL 833 >SB_34372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 27.5 bits (58), Expect = 9.8 Identities = 14/46 (30%), Positives = 25/46 (54%) Frame = +2 Query: 455 QSTFVHNKKTNT*PQAHSSISHDNCKLFYVIDNVVYYVSLNESIYA 592 Q+ + K TN P A SSI N Y+++N V +++L + ++ Sbjct: 33 QAKMLFRKLTNHSP-ARSSIESGNMMFHYILENSVCFLTLTDKPFS 77 >SB_27013| Best HMM Match : UME (HMM E-Value=4.4) Length = 199 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/40 (32%), Positives = 21/40 (52%), Gaps = 3/40 (7%) Frame = -3 Query: 565 VINYVVYHIKQFTI---IMRNTAMCLGLRISFLVMNKCRL 455 ++ Y+V I++F + N C +R+SFL N C L Sbjct: 32 IMRYIVSDIQEFASNNNMQLNPTKCKEMRVSFLHYNSCEL 71 >SB_20271| Best HMM Match : UME (HMM E-Value=8.1) Length = 335 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/40 (32%), Positives = 21/40 (52%), Gaps = 3/40 (7%) Frame = -3 Query: 565 VINYVVYHIKQFTI---IMRNTAMCLGLRISFLVMNKCRL 455 ++ Y+V I++F + N C +R+SFL N C L Sbjct: 32 IMRYIVSDIQEFASNNNMQLNPTKCKEMRVSFLHYNSCEL 71 >SB_17450| Best HMM Match : RVT_1 (HMM E-Value=2.2e-25) Length = 472 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/40 (32%), Positives = 21/40 (52%), Gaps = 3/40 (7%) Frame = -3 Query: 565 VINYVVYHIKQFTI---IMRNTAMCLGLRISFLVMNKCRL 455 ++ Y+V I++F + N C +R+SFL N C L Sbjct: 247 IMRYIVSDIQEFASNNNMQLNPTKCKEMRVSFLHYNSCEL 286 >SB_4015| Best HMM Match : F-box (HMM E-Value=5.9e-11) Length = 130 Score = 27.5 bits (58), Expect = 9.8 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +2 Query: 8 ILSHIFTFLPAKQLTKCREVCIRWKNV 88 +L +F+FL + L K VC RW+++ Sbjct: 33 VLLQVFSFLCQRSLCKLALVCKRWRDI 59 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,873,677 Number of Sequences: 59808 Number of extensions: 409156 Number of successful extensions: 1211 Number of sequences better than 10.0: 34 Number of HSP's better than 10.0 without gapping: 1117 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1205 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1620947750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -