BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1060 (642 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY146756-1|AAO12071.1| 282|Anopheles gambiae odorant-binding pr... 28 0.22 AY341224-1|AAR13788.1| 287|Anopheles gambiae TOLL9 protein. 24 3.6 AY341223-1|AAR13787.1| 287|Anopheles gambiae TOLL9 protein. 24 3.6 AY341222-1|AAR13786.1| 287|Anopheles gambiae TOLL9 protein. 24 3.6 AY341221-1|AAR13785.1| 287|Anopheles gambiae TOLL9 protein. 24 3.6 AY341220-1|AAR13784.1| 287|Anopheles gambiae TOLL9 protein. 24 3.6 AF444782-1|AAL37903.1| 576|Anopheles gambiae Toll9 protein. 24 3.6 DQ080831-1|AAY89477.1| 170|Anopheles gambiae transcription fact... 24 4.7 DQ080830-1|AAY89476.1| 170|Anopheles gambiae transcription fact... 24 4.7 DQ080829-1|AAY89475.1| 170|Anopheles gambiae transcription fact... 24 4.7 DQ080828-1|AAY89474.1| 170|Anopheles gambiae transcription fact... 24 4.7 DQ080827-1|AAY89473.1| 170|Anopheles gambiae transcription fact... 24 4.7 DQ080826-1|AAY89472.1| 170|Anopheles gambiae transcription fact... 24 4.7 DQ080825-1|AAY89471.1| 170|Anopheles gambiae transcription fact... 24 4.7 DQ080824-1|AAY89470.1| 170|Anopheles gambiae transcription fact... 24 4.7 DQ080823-1|AAY89469.1| 170|Anopheles gambiae transcription fact... 24 4.7 DQ080822-1|AAY89468.1| 170|Anopheles gambiae transcription fact... 24 4.7 DQ080821-1|AAY89467.1| 170|Anopheles gambiae transcription fact... 24 4.7 DQ080820-1|AAY89466.1| 170|Anopheles gambiae transcription fact... 24 4.7 DQ080819-1|AAY89465.1| 170|Anopheles gambiae transcription fact... 24 4.7 DQ080818-1|AAY89464.1| 170|Anopheles gambiae transcription fact... 24 4.7 DQ080817-1|AAY89463.1| 170|Anopheles gambiae transcription fact... 24 4.7 DQ080816-1|AAY89462.1| 170|Anopheles gambiae transcription fact... 24 4.7 DQ080815-1|AAY89461.1| 170|Anopheles gambiae transcription fact... 24 4.7 DQ080814-1|AAY89460.1| 170|Anopheles gambiae transcription fact... 24 4.7 DQ080813-1|AAY89459.1| 170|Anopheles gambiae transcription fact... 24 4.7 DQ080812-1|AAY89458.1| 170|Anopheles gambiae transcription fact... 24 4.7 DQ080811-1|AAY89457.1| 170|Anopheles gambiae transcription fact... 24 4.7 DQ080810-1|AAY89456.1| 170|Anopheles gambiae transcription fact... 24 4.7 DQ080809-1|AAY89455.1| 170|Anopheles gambiae transcription fact... 24 4.7 DQ080808-1|AAY89454.1| 170|Anopheles gambiae transcription fact... 24 4.7 DQ080807-1|AAY89453.1| 154|Anopheles gambiae transcription fact... 24 4.7 DQ080806-1|AAY89452.1| 154|Anopheles gambiae transcription fact... 24 4.7 DQ080805-1|AAY89451.1| 170|Anopheles gambiae transcription fact... 24 4.7 DQ080804-1|AAY89450.1| 170|Anopheles gambiae transcription fact... 24 4.7 DQ080803-1|AAY89449.1| 170|Anopheles gambiae transcription fact... 24 4.7 DQ080802-1|AAY89448.1| 170|Anopheles gambiae transcription fact... 24 4.7 DQ080801-1|AAY89447.1| 170|Anopheles gambiae transcription fact... 24 4.7 DQ080800-1|AAY89446.1| 170|Anopheles gambiae transcription fact... 24 4.7 DQ080799-1|AAY89445.1| 170|Anopheles gambiae transcription fact... 24 4.7 DQ080798-1|AAY89444.1| 170|Anopheles gambiae transcription fact... 24 4.7 DQ080797-1|AAY89443.1| 170|Anopheles gambiae transcription fact... 24 4.7 DQ080796-1|AAY89442.1| 170|Anopheles gambiae transcription fact... 24 4.7 DQ080795-1|AAY89441.1| 170|Anopheles gambiae transcription fact... 24 4.7 DQ080794-1|AAY89440.1| 170|Anopheles gambiae transcription fact... 24 4.7 DQ080793-1|AAY89439.1| 170|Anopheles gambiae transcription fact... 24 4.7 DQ080792-1|AAY89438.1| 170|Anopheles gambiae transcription fact... 24 4.7 DQ080791-1|AAY89437.1| 170|Anopheles gambiae transcription fact... 24 4.7 DQ080790-1|AAY89436.1| 170|Anopheles gambiae transcription fact... 24 4.7 DQ080789-1|AAY89435.1| 170|Anopheles gambiae transcription fact... 24 4.7 DQ080788-1|AAY89434.1| 170|Anopheles gambiae transcription fact... 24 4.7 AY462096-1|AAS21248.1| 603|Anopheles gambiae transposase protein. 24 4.7 >AY146756-1|AAO12071.1| 282|Anopheles gambiae odorant-binding protein AgamOBP40 protein. Length = 282 Score = 28.3 bits (60), Expect = 0.22 Identities = 10/23 (43%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = +2 Query: 308 IYETERPASTLKPAWC-IMIWTR 373 +Y+T++PA +P WC M W R Sbjct: 254 LYKTDQPAEDRQPPWCRTMCWIR 276 >AY341224-1|AAR13788.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 24.2 bits (50), Expect = 3.6 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = -3 Query: 556 YVVYHIKQFTIIMRNTAMCLGLRISFLVMNKCRLL 452 Y +HIK F IM+N+A+ L ++K LL Sbjct: 165 YYWFHIKYFFKIMKNSAVLSFFNDEKLYLDKSGLL 199 >AY341223-1|AAR13787.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 24.2 bits (50), Expect = 3.6 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = -3 Query: 556 YVVYHIKQFTIIMRNTAMCLGLRISFLVMNKCRLL 452 Y +HIK F IM+N+A+ L ++K LL Sbjct: 165 YYWFHIKYFFKIMKNSAVLSFFNDEKLYLDKSGLL 199 >AY341222-1|AAR13786.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 24.2 bits (50), Expect = 3.6 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = -3 Query: 556 YVVYHIKQFTIIMRNTAMCLGLRISFLVMNKCRLL 452 Y +HIK F IM+N+A+ L ++K LL Sbjct: 165 YYWFHIKYFFKIMKNSAVLSFFNDEKLYLDKSGLL 199 >AY341221-1|AAR13785.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 24.2 bits (50), Expect = 3.6 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = -3 Query: 556 YVVYHIKQFTIIMRNTAMCLGLRISFLVMNKCRLL 452 Y +HIK F IM+N+A+ L ++K LL Sbjct: 165 YYWFHIKYFFKIMKNSAVLSFFNDEKLYLDKSGLL 199 >AY341220-1|AAR13784.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 24.2 bits (50), Expect = 3.6 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = -3 Query: 556 YVVYHIKQFTIIMRNTAMCLGLRISFLVMNKCRLL 452 Y +HIK F IM+N+A+ L ++K LL Sbjct: 165 YYWFHIKYFFKIMKNSAVLSFFNDEKLYLDKSGLL 199 >AF444782-1|AAL37903.1| 576|Anopheles gambiae Toll9 protein. Length = 576 Score = 24.2 bits (50), Expect = 3.6 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = -3 Query: 556 YVVYHIKQFTIIMRNTAMCLGLRISFLVMNKCRLL 452 Y +HIK F IM+N+A+ L ++K LL Sbjct: 392 YYWFHIKYFFKIMKNSAVLSFFNDEKLYLDKSGLL 426 >DQ080831-1|AAY89477.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.8 bits (49), Expect = 4.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 386 FVRCSVSKS*YTTPALVWTPAVPFRKYL 303 F+ CS+ + TPAL + P RKY+ Sbjct: 37 FIFCSIFTFSFYTPALDYYLNHPIRKYI 64 >DQ080830-1|AAY89476.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.8 bits (49), Expect = 4.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 386 FVRCSVSKS*YTTPALVWTPAVPFRKYL 303 F+ CS+ + TPAL + P RKY+ Sbjct: 37 FIFCSIFTFSFYTPALDYYLNHPIRKYI 64 >DQ080829-1|AAY89475.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.8 bits (49), Expect = 4.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 386 FVRCSVSKS*YTTPALVWTPAVPFRKYL 303 F+ CS+ + TPAL + P RKY+ Sbjct: 37 FIFCSIFTFSFYTPALDYYLNHPIRKYI 64 >DQ080828-1|AAY89474.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.8 bits (49), Expect = 4.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 386 FVRCSVSKS*YTTPALVWTPAVPFRKYL 303 F+ CS+ + TPAL + P RKY+ Sbjct: 37 FIFCSIFTFSFYTPALDYYLNHPIRKYI 64 >DQ080827-1|AAY89473.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.8 bits (49), Expect = 4.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 386 FVRCSVSKS*YTTPALVWTPAVPFRKYL 303 F+ CS+ + TPAL + P RKY+ Sbjct: 37 FIFCSIFTFSFYTPALDYYLNHPIRKYI 64 >DQ080826-1|AAY89472.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.8 bits (49), Expect = 4.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 386 FVRCSVSKS*YTTPALVWTPAVPFRKYL 303 F+ CS+ + TPAL + P RKY+ Sbjct: 37 FIFCSIFTFSFYTPALDYYLNHPIRKYI 64 >DQ080825-1|AAY89471.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.8 bits (49), Expect = 4.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 386 FVRCSVSKS*YTTPALVWTPAVPFRKYL 303 F+ CS+ + TPAL + P RKY+ Sbjct: 37 FIFCSIFTFSFYTPALDYYLNHPIRKYI 64 >DQ080824-1|AAY89470.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.8 bits (49), Expect = 4.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 386 FVRCSVSKS*YTTPALVWTPAVPFRKYL 303 F+ CS+ + TPAL + P RKY+ Sbjct: 37 FIFCSIFTFSFYTPALDYYLNHPIRKYI 64 >DQ080823-1|AAY89469.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.8 bits (49), Expect = 4.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 386 FVRCSVSKS*YTTPALVWTPAVPFRKYL 303 F+ CS+ + TPAL + P RKY+ Sbjct: 37 FIFCSIFTFSFYTPALDYYLNHPIRKYI 64 >DQ080822-1|AAY89468.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.8 bits (49), Expect = 4.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 386 FVRCSVSKS*YTTPALVWTPAVPFRKYL 303 F+ CS+ + TPAL + P RKY+ Sbjct: 37 FIFCSIFTFSFYTPALDYYLNHPIRKYI 64 >DQ080821-1|AAY89467.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.8 bits (49), Expect = 4.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 386 FVRCSVSKS*YTTPALVWTPAVPFRKYL 303 F+ CS+ + TPAL + P RKY+ Sbjct: 37 FIFCSIFTFSFYTPALDYYLNHPIRKYI 64 >DQ080820-1|AAY89466.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.8 bits (49), Expect = 4.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 386 FVRCSVSKS*YTTPALVWTPAVPFRKYL 303 F+ CS+ + TPAL + P RKY+ Sbjct: 37 FIFCSIFTFSFYTPALDYYLNHPIRKYI 64 >DQ080819-1|AAY89465.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.8 bits (49), Expect = 4.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 386 FVRCSVSKS*YTTPALVWTPAVPFRKYL 303 F+ CS+ + TPAL + P RKY+ Sbjct: 37 FIFCSIFTFSFYTPALDYYLNHPIRKYI 64 >DQ080818-1|AAY89464.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.8 bits (49), Expect = 4.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 386 FVRCSVSKS*YTTPALVWTPAVPFRKYL 303 F+ CS+ + TPAL + P RKY+ Sbjct: 37 FIFCSIFTFSFYTPALDYYLNHPIRKYI 64 >DQ080817-1|AAY89463.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.8 bits (49), Expect = 4.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 386 FVRCSVSKS*YTTPALVWTPAVPFRKYL 303 F+ CS+ + TPAL + P RKY+ Sbjct: 37 FIFCSIFTFSFYTPALDYYLNHPIRKYI 64 >DQ080816-1|AAY89462.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.8 bits (49), Expect = 4.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 386 FVRCSVSKS*YTTPALVWTPAVPFRKYL 303 F+ CS+ + TPAL + P RKY+ Sbjct: 37 FIFCSIFTFSFYTPALDYYLNHPIRKYI 64 >DQ080815-1|AAY89461.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.8 bits (49), Expect = 4.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 386 FVRCSVSKS*YTTPALVWTPAVPFRKYL 303 F+ CS+ + TPAL + P RKY+ Sbjct: 37 FIFCSIFTFSFYTPALDYYLNHPIRKYI 64 >DQ080814-1|AAY89460.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.8 bits (49), Expect = 4.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 386 FVRCSVSKS*YTTPALVWTPAVPFRKYL 303 F+ CS+ + TPAL + P RKY+ Sbjct: 37 FIFCSIFTFSFYTPALDYYLNHPIRKYI 64 >DQ080813-1|AAY89459.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.8 bits (49), Expect = 4.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 386 FVRCSVSKS*YTTPALVWTPAVPFRKYL 303 F+ CS+ + TPAL + P RKY+ Sbjct: 37 FIFCSIFTFSFYTPALDYYLNHPIRKYI 64 >DQ080812-1|AAY89458.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.8 bits (49), Expect = 4.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 386 FVRCSVSKS*YTTPALVWTPAVPFRKYL 303 F+ CS+ + TPAL + P RKY+ Sbjct: 37 FIFCSIFTFSFYTPALDYYLNHPIRKYI 64 >DQ080811-1|AAY89457.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.8 bits (49), Expect = 4.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 386 FVRCSVSKS*YTTPALVWTPAVPFRKYL 303 F+ CS+ + TPAL + P RKY+ Sbjct: 37 FIFCSIFTFSFYTPALDYYLNHPIRKYI 64 >DQ080810-1|AAY89456.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.8 bits (49), Expect = 4.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 386 FVRCSVSKS*YTTPALVWTPAVPFRKYL 303 F+ CS+ + TPAL + P RKY+ Sbjct: 37 FIFCSIFTFSFYTPALDYYLNHPIRKYI 64 >DQ080809-1|AAY89455.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.8 bits (49), Expect = 4.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 386 FVRCSVSKS*YTTPALVWTPAVPFRKYL 303 F+ CS+ + TPAL + P RKY+ Sbjct: 37 FIFCSIFTFSFYTPALDYYLNHPIRKYI 64 >DQ080808-1|AAY89454.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.8 bits (49), Expect = 4.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 386 FVRCSVSKS*YTTPALVWTPAVPFRKYL 303 F+ CS+ + TPAL + P RKY+ Sbjct: 37 FIFCSIFTFSFYTPALDYYLNHPIRKYI 64 >DQ080807-1|AAY89453.1| 154|Anopheles gambiae transcription factor 3C protein. Length = 154 Score = 23.8 bits (49), Expect = 4.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 386 FVRCSVSKS*YTTPALVWTPAVPFRKYL 303 F+ CS+ + TPAL + P RKY+ Sbjct: 26 FIFCSIFTFSFYTPALDYYLNHPIRKYI 53 >DQ080806-1|AAY89452.1| 154|Anopheles gambiae transcription factor 3C protein. Length = 154 Score = 23.8 bits (49), Expect = 4.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 386 FVRCSVSKS*YTTPALVWTPAVPFRKYL 303 F+ CS+ + TPAL + P RKY+ Sbjct: 26 FIFCSIFTFSFYTPALDYYLNHPIRKYI 53 >DQ080805-1|AAY89451.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.8 bits (49), Expect = 4.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 386 FVRCSVSKS*YTTPALVWTPAVPFRKYL 303 F+ CS+ + TPAL + P RKY+ Sbjct: 37 FIFCSIFTFSFYTPALDYYLNHPIRKYI 64 >DQ080804-1|AAY89450.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.8 bits (49), Expect = 4.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 386 FVRCSVSKS*YTTPALVWTPAVPFRKYL 303 F+ CS+ + TPAL + P RKY+ Sbjct: 37 FIFCSIFTFSFYTPALDYYLNHPIRKYI 64 >DQ080803-1|AAY89449.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.8 bits (49), Expect = 4.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 386 FVRCSVSKS*YTTPALVWTPAVPFRKYL 303 F+ CS+ + TPAL + P RKY+ Sbjct: 37 FIFCSIFTFSFYTPALDYYLNHPIRKYI 64 >DQ080802-1|AAY89448.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.8 bits (49), Expect = 4.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 386 FVRCSVSKS*YTTPALVWTPAVPFRKYL 303 F+ CS+ + TPAL + P RKY+ Sbjct: 37 FIFCSIFTFSFYTPALDYYLNHPIRKYI 64 >DQ080801-1|AAY89447.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.8 bits (49), Expect = 4.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 386 FVRCSVSKS*YTTPALVWTPAVPFRKYL 303 F+ CS+ + TPAL + P RKY+ Sbjct: 37 FIFCSIFTFSFYTPALDYYLNHPIRKYI 64 >DQ080800-1|AAY89446.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.8 bits (49), Expect = 4.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 386 FVRCSVSKS*YTTPALVWTPAVPFRKYL 303 F+ CS+ + TPAL + P RKY+ Sbjct: 37 FIFCSIFTFSFYTPALDYYLNHPIRKYI 64 >DQ080799-1|AAY89445.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.8 bits (49), Expect = 4.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 386 FVRCSVSKS*YTTPALVWTPAVPFRKYL 303 F+ CS+ + TPAL + P RKY+ Sbjct: 37 FIFCSIFTFSFYTPALDYYLNHPIRKYI 64 >DQ080798-1|AAY89444.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.8 bits (49), Expect = 4.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 386 FVRCSVSKS*YTTPALVWTPAVPFRKYL 303 F+ CS+ + TPAL + P RKY+ Sbjct: 37 FIFCSIFTFSFYTPALDYYLNHPIRKYI 64 >DQ080797-1|AAY89443.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.8 bits (49), Expect = 4.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 386 FVRCSVSKS*YTTPALVWTPAVPFRKYL 303 F+ CS+ + TPAL + P RKY+ Sbjct: 37 FIFCSIFTFSFYTPALDYYLNHPIRKYI 64 >DQ080796-1|AAY89442.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.8 bits (49), Expect = 4.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 386 FVRCSVSKS*YTTPALVWTPAVPFRKYL 303 F+ CS+ + TPAL + P RKY+ Sbjct: 37 FIFCSIFTFSFYTPALDYYLNHPIRKYI 64 >DQ080795-1|AAY89441.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.8 bits (49), Expect = 4.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 386 FVRCSVSKS*YTTPALVWTPAVPFRKYL 303 F+ CS+ + TPAL + P RKY+ Sbjct: 37 FIFCSIFTFSFYTPALDYYLNHPIRKYI 64 >DQ080794-1|AAY89440.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.8 bits (49), Expect = 4.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 386 FVRCSVSKS*YTTPALVWTPAVPFRKYL 303 F+ CS+ + TPAL + P RKY+ Sbjct: 37 FIFCSIFTFSFYTPALDYYLNHPIRKYI 64 >DQ080793-1|AAY89439.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.8 bits (49), Expect = 4.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 386 FVRCSVSKS*YTTPALVWTPAVPFRKYL 303 F+ CS+ + TPAL + P RKY+ Sbjct: 37 FIFCSIFTFSFYTPALDYYLNHPIRKYI 64 >DQ080792-1|AAY89438.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.8 bits (49), Expect = 4.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 386 FVRCSVSKS*YTTPALVWTPAVPFRKYL 303 F+ CS+ + TPAL + P RKY+ Sbjct: 37 FIFCSIFTFSFYTPALDYYLNHPIRKYI 64 >DQ080791-1|AAY89437.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.8 bits (49), Expect = 4.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 386 FVRCSVSKS*YTTPALVWTPAVPFRKYL 303 F+ CS+ + TPAL + P RKY+ Sbjct: 37 FIFCSIFTFSFYTPALDYYLNHPIRKYI 64 >DQ080790-1|AAY89436.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.8 bits (49), Expect = 4.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 386 FVRCSVSKS*YTTPALVWTPAVPFRKYL 303 F+ CS+ + TPAL + P RKY+ Sbjct: 37 FIFCSIFTFSFYTPALDYYLNHPIRKYI 64 >DQ080789-1|AAY89435.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.8 bits (49), Expect = 4.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 386 FVRCSVSKS*YTTPALVWTPAVPFRKYL 303 F+ CS+ + TPAL + P RKY+ Sbjct: 37 FIFCSIFTFSFYTPALDYYLNHPIRKYI 64 >DQ080788-1|AAY89434.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.8 bits (49), Expect = 4.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 386 FVRCSVSKS*YTTPALVWTPAVPFRKYL 303 F+ CS+ + TPAL + P RKY+ Sbjct: 37 FIFCSIFTFSFYTPALDYYLNHPIRKYI 64 >AY462096-1|AAS21248.1| 603|Anopheles gambiae transposase protein. Length = 603 Score = 23.8 bits (49), Expect = 4.7 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +2 Query: 44 QLTKCREVCIRWKNVIDTLNKYH 112 QL +EV RW + D LN+++ Sbjct: 318 QLKMIQEVSTRWNSGYDMLNRFY 340 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 680,046 Number of Sequences: 2352 Number of extensions: 14789 Number of successful extensions: 71 Number of sequences better than 10.0: 52 Number of HSP's better than 10.0 without gapping: 71 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 71 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 63141405 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -