BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1059 (552 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_47560| Best HMM Match : CM_2 (HMM E-Value=0.82) 27 7.7 SB_26621| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 >SB_47560| Best HMM Match : CM_2 (HMM E-Value=0.82) Length = 384 Score = 27.5 bits (58), Expect = 7.7 Identities = 14/37 (37%), Positives = 18/37 (48%), Gaps = 4/37 (10%) Frame = -3 Query: 106 TKAAPPNPPAEDR----NAVAISKCFLPTRTIFNSSW 8 +K PP PP+ED N + P + IF SSW Sbjct: 243 SKTPPPPPPSEDEHEPDNISTDTFTITPEQAIFQSSW 279 >SB_26621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 359 Score = 27.5 bits (58), Expect = 7.7 Identities = 13/40 (32%), Positives = 25/40 (62%) Frame = -3 Query: 121 KYRSVTKAAPPNPPAEDRNAVAISKCFLPTRTIFNSSWYF 2 +YR+VT+++ PP+ + A+ I +L +F+SS +F Sbjct: 128 RYRAVTRSSCAAPPSRRQIAITILISWLIPLLMFSSSLHF 167 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,671,621 Number of Sequences: 59808 Number of extensions: 279830 Number of successful extensions: 447 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 433 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 447 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1276425465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -