BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1055 (570 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 33 0.002 L01589-1|AAA27736.1| 81|Apis mellifera zinc finger protein pro... 27 0.13 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 26 0.30 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 26 0.30 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 26 0.30 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 26 0.30 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 25 0.40 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 25 0.40 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 25 0.40 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 25 0.53 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 25 0.53 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 25 0.53 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 25 0.53 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 25 0.53 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 25 0.53 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 25 0.53 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 25 0.70 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 25 0.70 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 25 0.70 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 24 0.92 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 24 1.2 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 23 1.6 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 23 1.6 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 23 1.6 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 23 1.6 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 23 1.6 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 23 2.1 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 4.9 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 4.9 DQ855486-1|ABH88173.1| 104|Apis mellifera chemosensory protein ... 21 6.5 DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex det... 21 8.6 DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 21 8.6 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 33.1 bits (72), Expect = 0.002 Identities = 15/55 (27%), Positives = 25/55 (45%) Frame = +3 Query: 342 EVKRQICKKCRSILIENVSTNMKIRNHNKLKRIEWKCNICGERKGLPAEKNKDHR 506 E K C C+ + +R+H K ++CNICG+ +PA + +R Sbjct: 58 EEKTYQCLLCQKAFDQKNLYQSHLRSHGKEGEDPYRCNICGKTFAVPARLTRHYR 112 >L01589-1|AAA27736.1| 81|Apis mellifera zinc finger protein protein. Length = 81 Score = 27.1 bits (57), Expect = 0.13 Identities = 12/41 (29%), Positives = 19/41 (46%) Frame = +3 Query: 360 CKKCRSILIENVSTNMKIRNHNKLKRIEWKCNICGERKGLP 482 CK C + + + M IR H + KC++CG+ P Sbjct: 19 CKYCEKVYVSLGALKMHIRTHT----LPCKCHLCGKAFSRP 55 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 25.8 bits (54), Expect = 0.30 Identities = 20/75 (26%), Positives = 37/75 (49%) Frame = +2 Query: 143 RTENNIIVLLLNKIKCDKKYRETMLFNESIIYIK*VKHGFQEHNTIFILRESCSKYSQKE 322 + E + VL++N IK K E+ + S ++ HGFQ ++ + SCS+ +E Sbjct: 177 KIEEHDTVLVVN-IK--KSGNESKKYATSSNSLRSRTHGFQHTSSRYSRERSCSRDRNRE 233 Query: 323 CPQNTPRGKKANMQK 367 + R +K + +K Sbjct: 234 YKEKDRRYEKLHNEK 248 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 25.8 bits (54), Expect = 0.30 Identities = 20/75 (26%), Positives = 37/75 (49%) Frame = +2 Query: 143 RTENNIIVLLLNKIKCDKKYRETMLFNESIIYIK*VKHGFQEHNTIFILRESCSKYSQKE 322 + E + VL++N IK K E+ + S ++ HGFQ ++ + SCS+ +E Sbjct: 188 KIEEHDTVLVVN-IK--KSGNESKKYATSSNSLRSRTHGFQHTSSHYSRERSCSRDRNRE 244 Query: 323 CPQNTPRGKKANMQK 367 + R +K + +K Sbjct: 245 YKEKDRRYEKLHNEK 259 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 25.8 bits (54), Expect = 0.30 Identities = 20/75 (26%), Positives = 37/75 (49%) Frame = +2 Query: 143 RTENNIIVLLLNKIKCDKKYRETMLFNESIIYIK*VKHGFQEHNTIFILRESCSKYSQKE 322 + E + VL++N IK K E+ + S ++ HGFQ ++ + SCS+ +E Sbjct: 188 KIEEHDTVLVVN-IK--KSGNESKKYATSSNSLRSRTHGFQHTSSRYSRERSCSRDRNRE 244 Query: 323 CPQNTPRGKKANMQK 367 + R +K + +K Sbjct: 245 YKEKDRRYEKLHNEK 259 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 25.8 bits (54), Expect = 0.30 Identities = 18/75 (24%), Positives = 36/75 (48%) Frame = +2 Query: 143 RTENNIIVLLLNKIKCDKKYRETMLFNESIIYIK*VKHGFQEHNTIFILRESCSKYSQKE 322 + E + VL++N +K E+ + S ++ HGFQ ++ + SCS+ +E Sbjct: 188 KIEEHDTVLVVN---IEKSGNESKKYATSSNSLRNRTHGFQHTSSRYSRERSCSRDRNRE 244 Query: 323 CPQNTPRGKKANMQK 367 + R +K + +K Sbjct: 245 YKKKDRRYEKLHNEK 259 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 25.4 bits (53), Expect = 0.40 Identities = 24/115 (20%), Positives = 50/115 (43%) Frame = +2 Query: 182 IKCDKKYRETMLFNESIIYIK*VKHGFQEHNTIFILRESCSKYSQKECPQNTPRGKKANM 361 + +K E+ + S ++ HGFQ ++ + SCS+ +E + R +K + Sbjct: 198 VNIEKSGNESKKYATSSNSLRNRTHGFQHTSSRYSRERSCSRDRNREYRKKDRRYEKLHN 257 Query: 362 QKV*KHPHRKCID*YENKKSQ*IKENRMEM*HLWREKRFAS*KK*RPQSXVEKKK 526 +K R Y + + K + E + +R+ R S ++ R ++ E+ K Sbjct: 258 EKEKLLEERTSRKRYSRSREREQKSYKNE--NSYRKYRETSKERSRDRTERERSK 310 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 25.4 bits (53), Expect = 0.40 Identities = 24/115 (20%), Positives = 50/115 (43%) Frame = +2 Query: 182 IKCDKKYRETMLFNESIIYIK*VKHGFQEHNTIFILRESCSKYSQKECPQNTPRGKKANM 361 + +K E+ + S ++ HGFQ ++ + SCS+ +E + R +K + Sbjct: 203 VNIEKSGNESKKYATSSNSLRNRTHGFQHTSSRYSRERSCSRDRNREYRKKDRRYEKLHN 262 Query: 362 QKV*KHPHRKCID*YENKKSQ*IKENRMEM*HLWREKRFAS*KK*RPQSXVEKKK 526 +K R Y + + K + E + +R+ R S ++ R ++ E+ K Sbjct: 263 EKEKLLEERTSRKRYSRSREREQKSYKNE--NSYRKYRETSKERSRDKTERERSK 315 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 25.4 bits (53), Expect = 0.40 Identities = 14/62 (22%), Positives = 29/62 (46%) Frame = +2 Query: 182 IKCDKKYRETMLFNESIIYIK*VKHGFQEHNTIFILRESCSKYSQKECPQNTPRGKKANM 361 + +K E+ + S ++ HGFQ ++ + SCS+ +E + R +K + Sbjct: 198 VNIEKSGNESKKYATSSNSLRNRTHGFQHTSSRYSRERSCSRDRNREYREKDRRYEKLHN 257 Query: 362 QK 367 +K Sbjct: 258 EK 259 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 25.0 bits (52), Expect = 0.53 Identities = 20/75 (26%), Positives = 37/75 (49%) Frame = +2 Query: 143 RTENNIIVLLLNKIKCDKKYRETMLFNESIIYIK*VKHGFQEHNTIFILRESCSKYSQKE 322 + E + VL++N IK K E+ + S ++ HGFQ ++ + SCS+ +E Sbjct: 188 KIEEHDTVLVVN-IK--KSGNESKKYATSSNSLRSRTHGFQHTSSRYSRERSCSRDRNRE 244 Query: 323 CPQNTPRGKKANMQK 367 + R +K + +K Sbjct: 245 YRKKDRRYEKLHNEK 259 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 25.0 bits (52), Expect = 0.53 Identities = 20/75 (26%), Positives = 37/75 (49%) Frame = +2 Query: 143 RTENNIIVLLLNKIKCDKKYRETMLFNESIIYIK*VKHGFQEHNTIFILRESCSKYSQKE 322 + E + VL++N IK K E+ + S ++ HGFQ ++ + SCS+ +E Sbjct: 188 KIEEHDTVLVVN-IK--KSGNESKKYATSSNSLRSRTHGFQHTSSHYSRERSCSRDRNRE 244 Query: 323 CPQNTPRGKKANMQK 367 + R +K + +K Sbjct: 245 YRKKDRRYEKLHNEK 259 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 25.0 bits (52), Expect = 0.53 Identities = 20/75 (26%), Positives = 37/75 (49%) Frame = +2 Query: 143 RTENNIIVLLLNKIKCDKKYRETMLFNESIIYIK*VKHGFQEHNTIFILRESCSKYSQKE 322 + E + VL++N IK K E+ + S ++ HGFQ ++ + SCS+ +E Sbjct: 188 KIEEHDTVLVVN-IK--KSGNESKKYATSSNSLRSRTHGFQHTSSHYSRERSCSRDRNRE 244 Query: 323 CPQNTPRGKKANMQK 367 + R +K + +K Sbjct: 245 YRKKDRRYEKLHNEK 259 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 25.0 bits (52), Expect = 0.53 Identities = 20/75 (26%), Positives = 37/75 (49%) Frame = +2 Query: 143 RTENNIIVLLLNKIKCDKKYRETMLFNESIIYIK*VKHGFQEHNTIFILRESCSKYSQKE 322 + E + VL++N IK K E+ + S ++ HGFQ ++ + SCS+ +E Sbjct: 188 KIEEHDTVLVVN-IK--KSGNESKKYATSSNSLRSRTHGFQHTSSHYSRERSCSRDRNRE 244 Query: 323 CPQNTPRGKKANMQK 367 + R +K + +K Sbjct: 245 YRKKDRRYEKLHNEK 259 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 25.0 bits (52), Expect = 0.53 Identities = 20/75 (26%), Positives = 37/75 (49%) Frame = +2 Query: 143 RTENNIIVLLLNKIKCDKKYRETMLFNESIIYIK*VKHGFQEHNTIFILRESCSKYSQKE 322 + E + VL++N IK K E+ + S ++ HGFQ ++ + SCS+ +E Sbjct: 188 KIEEHDTVLVVN-IK--KSGNESKKYATSSNSLRSRTHGFQHTSSHYSRERSCSRDRNRE 244 Query: 323 CPQNTPRGKKANMQK 367 + R +K + +K Sbjct: 245 YRKKDRRYEKLHNEK 259 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 25.0 bits (52), Expect = 0.53 Identities = 20/75 (26%), Positives = 37/75 (49%) Frame = +2 Query: 143 RTENNIIVLLLNKIKCDKKYRETMLFNESIIYIK*VKHGFQEHNTIFILRESCSKYSQKE 322 + E + VL++N IK K E+ + S ++ HGFQ ++ + SCS+ +E Sbjct: 177 KIEEHDTVLVVN-IK--KSGNESKKYATSSNSLRSRTHGFQHTSSHYSRERSCSRDRNRE 233 Query: 323 CPQNTPRGKKANMQK 367 + R +K + +K Sbjct: 234 YRKKDRRYEKLHNEK 248 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 25.0 bits (52), Expect = 0.53 Identities = 20/75 (26%), Positives = 37/75 (49%) Frame = +2 Query: 143 RTENNIIVLLLNKIKCDKKYRETMLFNESIIYIK*VKHGFQEHNTIFILRESCSKYSQKE 322 + E + VL++N IK K E+ + S ++ HGFQ ++ + SCS+ +E Sbjct: 188 KIEEHDTVLVVN-IK--KSGNESKKYATSSNSLRSRTHGFQHTSSRYSRERSCSRDRNRE 244 Query: 323 CPQNTPRGKKANMQK 367 + R +K + +K Sbjct: 245 YRKKDRRYEKLHNEK 259 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 24.6 bits (51), Expect = 0.70 Identities = 17/75 (22%), Positives = 37/75 (49%) Frame = +2 Query: 143 RTENNIIVLLLNKIKCDKKYRETMLFNESIIYIK*VKHGFQEHNTIFILRESCSKYSQKE 322 + E + VL++N +K +E+ + S ++ HGFQ ++ + SCS+ +E Sbjct: 177 KIEEHDTVLVVN---IEKSGKESKKYATSSNSLRNRTHGFQHTSSRYSRERSCSRDRNRE 233 Query: 323 CPQNTPRGKKANMQK 367 + + +K + +K Sbjct: 234 YRKKDRQYEKLHNEK 248 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 24.6 bits (51), Expect = 0.70 Identities = 17/75 (22%), Positives = 37/75 (49%) Frame = +2 Query: 143 RTENNIIVLLLNKIKCDKKYRETMLFNESIIYIK*VKHGFQEHNTIFILRESCSKYSQKE 322 + E + VL++N +K +E+ + S ++ HGFQ ++ + SCS+ +E Sbjct: 188 KIEEHDTVLVVN---IEKSGKESKKYATSSNSLRNRTHGFQHTSSRYSRERSCSRDRNRE 244 Query: 323 CPQNTPRGKKANMQK 367 + + +K + +K Sbjct: 245 YRKKDRQYEKLHNEK 259 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 24.6 bits (51), Expect = 0.70 Identities = 17/75 (22%), Positives = 37/75 (49%) Frame = +2 Query: 143 RTENNIIVLLLNKIKCDKKYRETMLFNESIIYIK*VKHGFQEHNTIFILRESCSKYSQKE 322 + E + VL++N +K +E+ + S ++ HGFQ ++ + SCS+ +E Sbjct: 177 KIEEHDTVLVVN---IEKSGKESKKYATSSNSLRNRTHGFQHTSSRYSRERSCSRDRNRE 233 Query: 323 CPQNTPRGKKANMQK 367 + + +K + +K Sbjct: 234 YRKKDRQYEKLHNEK 248 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 24.2 bits (50), Expect = 0.92 Identities = 13/62 (20%), Positives = 30/62 (48%) Frame = +2 Query: 182 IKCDKKYRETMLFNESIIYIK*VKHGFQEHNTIFILRESCSKYSQKECPQNTPRGKKANM 361 + +K +E+ + S ++ HGFQ ++ + SCS+ +E + + +K + Sbjct: 198 VNIEKSGKESKKYATSSNSLRNRTHGFQHTSSRYSRERSCSRDRNREYRKKDRQYEKLHN 257 Query: 362 QK 367 +K Sbjct: 258 EK 259 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 23.8 bits (49), Expect = 1.2 Identities = 13/62 (20%), Positives = 29/62 (46%) Frame = +2 Query: 182 IKCDKKYRETMLFNESIIYIK*VKHGFQEHNTIFILRESCSKYSQKECPQNTPRGKKANM 361 + +K E+ + S ++ HGFQ ++ + SCS+ +E + + +K + Sbjct: 187 VNIEKSENESKKYATSSNSLRNRTHGFQHTSSRYSRERSCSRDRNREYRKKDRQYEKLHN 246 Query: 362 QK 367 +K Sbjct: 247 EK 248 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 23.4 bits (48), Expect = 1.6 Identities = 19/75 (25%), Positives = 37/75 (49%) Frame = +2 Query: 143 RTENNIIVLLLNKIKCDKKYRETMLFNESIIYIK*VKHGFQEHNTIFILRESCSKYSQKE 322 + E + VL++N IK K E+ + S ++ HGFQ ++ + SCS+ +E Sbjct: 177 KIEEHDTVLVVN-IK--KSGNESKKYATSSNSLRSRTHGFQHTSSRYSRERSCSRDRNRE 233 Query: 323 CPQNTPRGKKANMQK 367 + + +K + +K Sbjct: 234 YRKKDRQYEKLHNEK 248 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.4 bits (48), Expect = 1.6 Identities = 19/75 (25%), Positives = 37/75 (49%) Frame = +2 Query: 143 RTENNIIVLLLNKIKCDKKYRETMLFNESIIYIK*VKHGFQEHNTIFILRESCSKYSQKE 322 + E + VL++N IK K E+ + S ++ HGFQ ++ + SCS+ +E Sbjct: 188 KIEEHDTVLVVN-IK--KSGNESKKYATSSNSLRSRTHGFQHTSSRYSRERSCSRDRNRE 244 Query: 323 CPQNTPRGKKANMQK 367 + + +K + +K Sbjct: 245 YRKKDRQYEKLHNEK 259 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 23.4 bits (48), Expect = 1.6 Identities = 19/75 (25%), Positives = 37/75 (49%) Frame = +2 Query: 143 RTENNIIVLLLNKIKCDKKYRETMLFNESIIYIK*VKHGFQEHNTIFILRESCSKYSQKE 322 + E + VL++N IK K E+ + S ++ HGFQ ++ + SCS+ +E Sbjct: 188 KIEEHDTVLVVN-IK--KSGNESKKYATSSNSLRSRTHGFQHTSSRYSRERSCSRDRNRE 244 Query: 323 CPQNTPRGKKANMQK 367 + + +K + +K Sbjct: 245 YRKKDRQYEKLHNEK 259 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 23.4 bits (48), Expect = 1.6 Identities = 13/62 (20%), Positives = 29/62 (46%) Frame = +2 Query: 182 IKCDKKYRETMLFNESIIYIK*VKHGFQEHNTIFILRESCSKYSQKECPQNTPRGKKANM 361 + +K E+ + S ++ HGFQ ++ + SCS+ +E + + +K + Sbjct: 198 VNIEKSGNESKKYATSSNSLRSRTHGFQHTSSRYSRERSCSRDRNREYRKKDRQYEKLHN 257 Query: 362 QK 367 +K Sbjct: 258 EK 259 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 23.4 bits (48), Expect = 1.6 Identities = 13/62 (20%), Positives = 29/62 (46%) Frame = +2 Query: 182 IKCDKKYRETMLFNESIIYIK*VKHGFQEHNTIFILRESCSKYSQKECPQNTPRGKKANM 361 + +K E+ + S ++ HGFQ ++ + SCS+ +E + + +K + Sbjct: 198 VNIEKSGNESKKYATSSNSLRSRTHGFQHTSSRYSRERSCSRDRNREYRKKDRQYEKLHN 257 Query: 362 QK 367 +K Sbjct: 258 EK 259 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 23.0 bits (47), Expect = 2.1 Identities = 13/62 (20%), Positives = 28/62 (45%) Frame = +2 Query: 182 IKCDKKYRETMLFNESIIYIK*VKHGFQEHNTIFILRESCSKYSQKECPQNTPRGKKANM 361 + +K E+ + S ++ H FQ ++ + SCS+ +E + R +K + Sbjct: 198 VNIEKSGNESKKYATSSNSLRSRTHDFQHTSSRYSRERSCSRDRNREYKEKDRRYEKLHN 257 Query: 362 QK 367 +K Sbjct: 258 EK 259 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.8 bits (44), Expect = 4.9 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -1 Query: 501 GLYFFQLANLFSRHRCYISIL 439 G YF Q +NL+ R + + +L Sbjct: 883 GAYFCQASNLYGRDQQLVQLL 903 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.8 bits (44), Expect = 4.9 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -1 Query: 501 GLYFFQLANLFSRHRCYISIL 439 G YF Q +NL+ R + + +L Sbjct: 879 GAYFCQASNLYGRDQQLVQLL 899 >DQ855486-1|ABH88173.1| 104|Apis mellifera chemosensory protein 5 protein. Length = 104 Score = 21.4 bits (43), Expect = 6.5 Identities = 10/40 (25%), Positives = 18/40 (45%) Frame = +3 Query: 306 NIAKKNVLKIHPEVKRQICKKCRSILIENVSTNMKIRNHN 425 ++ K + ++ PEV C +C S I +T + N Sbjct: 47 DVIGKKIKELLPEVLNNHCNRCTSRQIGIANTLIPFMQQN 86 >DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 21.0 bits (42), Expect = 8.6 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = +1 Query: 85 LSNNFLKFSLNPRIKSYGNKNRKQHNCITF 174 LSNN+ + N +Y N N+K + I + Sbjct: 85 LSNNYNYSNYNNYNNNYNNYNKKLYYNINY 114 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 21.0 bits (42), Expect = 8.6 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +3 Query: 393 VSTNMKIRNHNKL 431 +ST K RNH KL Sbjct: 128 ISTGQKWRNHRKL 140 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 158,655 Number of Sequences: 438 Number of extensions: 3803 Number of successful extensions: 32 Number of sequences better than 10.0: 32 Number of HSP's better than 10.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16381902 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -