BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1052 (558 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q75C93 Cluster: ACR023Wp; n=1; Eremothecium gossypii|Re... 35 1.1 UniRef50_A5NWR2 Cluster: Putative uncharacterized protein; n=2; ... 34 2.6 UniRef50_Q4JN17 Cluster: Predicted outer membrane protein SMc027... 33 3.4 UniRef50_UPI0000F2C24B Cluster: PREDICTED: hypothetical protein;... 33 4.5 UniRef50_Q01ZQ0 Cluster: Putative uncharacterized protein precur... 33 4.5 UniRef50_Q9UIL4 Cluster: Kinesin-like protein KIF25; n=2; Euther... 33 6.0 >UniRef50_Q75C93 Cluster: ACR023Wp; n=1; Eremothecium gossypii|Rep: ACR023Wp - Ashbya gossypii (Yeast) (Eremothecium gossypii) Length = 769 Score = 35.1 bits (77), Expect = 1.1 Identities = 14/30 (46%), Positives = 20/30 (66%) Frame = +1 Query: 7 PRPSEPKPTSPARGAPCRPTNEALARRGRH 96 P P +P+PTSPA+ A RP++ +L G H Sbjct: 550 PPPGDPQPTSPAQNATRRPSDASLGYPGSH 579 >UniRef50_A5NWR2 Cluster: Putative uncharacterized protein; n=2; Methylobacterium sp. 4-46|Rep: Putative uncharacterized protein - Methylobacterium sp. 4-46 Length = 206 Score = 33.9 bits (74), Expect = 2.6 Identities = 19/46 (41%), Positives = 24/46 (52%), Gaps = 2/46 (4%) Frame = +1 Query: 4 LPRPSEPKPTSPARGAPCRPTNEA--LARRGRHGTTVAYIVDDSGS 135 LPRPS PT P R P P A LARR H ++++ + GS Sbjct: 142 LPRPSAATPTKPERPPPRTPAPSAPQLARRD-HPAEASFLIGEKGS 186 >UniRef50_Q4JN17 Cluster: Predicted outer membrane protein SMc02721; n=1; uncultured bacterium BAC13K9BAC|Rep: Predicted outer membrane protein SMc02721 - uncultured bacterium BAC13K9BAC Length = 731 Score = 33.5 bits (73), Expect = 3.4 Identities = 22/62 (35%), Positives = 29/62 (46%) Frame = -1 Query: 228 SMTAKSYISKYDTEXXXXXXXXXXXRWKFMVGARVVNDVGDGGSVTTTPRQSLVCWSAGC 49 S+TAK Y +KY WK VG V+D G G T+T + S + W+ C Sbjct: 289 SLTAKIYKAKYSRN------------WK-KVGEMTVDDDGSAGGDTSTVKMSAIDWTTNC 335 Query: 48 AA 43 AA Sbjct: 336 AA 337 >UniRef50_UPI0000F2C24B Cluster: PREDICTED: hypothetical protein; n=1; Monodelphis domestica|Rep: PREDICTED: hypothetical protein - Monodelphis domestica Length = 466 Score = 33.1 bits (72), Expect = 4.5 Identities = 20/54 (37%), Positives = 33/54 (61%) Frame = +1 Query: 280 LLSKALGVDFILIVIICVNVSPKYGSDTLINLGYCLRSLVSTFLQRTPAIRESL 441 LL ++G D L+V++CV+ KY ++TL +LG+ R + +QR A R +L Sbjct: 374 LLQDSIGGDAKLLVLLCVSPCQKYLAETLQSLGFGSR---ARQVQRVQAKRRNL 424 >UniRef50_Q01ZQ0 Cluster: Putative uncharacterized protein precursor; n=1; Solibacter usitatus Ellin6076|Rep: Putative uncharacterized protein precursor - Solibacter usitatus (strain Ellin6076) Length = 697 Score = 33.1 bits (72), Expect = 4.5 Identities = 16/41 (39%), Positives = 22/41 (53%) Frame = +1 Query: 10 RPSEPKPTSPARGAPCRPTNEALARRGRHGTTVAYIVDDSG 132 R + KP +P +G P P+ AR + TVA +VDD G Sbjct: 79 RATSAKPAAPVKGVPPPPSPPMAARPKQIRRTVALVVDDLG 119 >UniRef50_Q9UIL4 Cluster: Kinesin-like protein KIF25; n=2; Eutheria|Rep: Kinesin-like protein KIF25 - Homo sapiens (Human) Length = 384 Score = 32.7 bits (71), Expect = 6.0 Identities = 19/49 (38%), Positives = 30/49 (61%) Frame = +1 Query: 280 LLSKALGVDFILIVIICVNVSPKYGSDTLINLGYCLRSLVSTFLQRTPA 426 LL LG D L+VI+C++ S ++ + TL LG+ +R + +QR PA Sbjct: 323 LLQDCLGGDAKLLVILCISPSQRHLAQTLQGLGFGIR---ARQVQRGPA 368 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 493,323,414 Number of Sequences: 1657284 Number of extensions: 8813724 Number of successful extensions: 25724 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 23602 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25594 length of database: 575,637,011 effective HSP length: 96 effective length of database: 416,537,747 effective search space used: 37071859483 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -