BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1048 (640 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 25 2.7 AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific tran... 25 2.7 AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-s... 25 2.7 AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-spe... 25 2.7 M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein. 23 8.2 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 23 8.2 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 24.6 bits (51), Expect = 2.7 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = -2 Query: 282 SASENQVSLAQKAQGAPQSSGKSHDEPKTAPKSAAEREI 166 ++S + SL + QG +S SH K +PK E ++ Sbjct: 362 NSSPSTPSLMNERQGGYESQASSHSSFKQSPKPEDEFKV 400 >AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific transcription factor FRU-MB protein. Length = 759 Score = 24.6 bits (51), Expect = 2.7 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = -2 Query: 282 SASENQVSLAQKAQGAPQSSGKSHDEPKTAPKSAAEREI 166 ++S + SL + QG +S SH K +PK E ++ Sbjct: 362 NSSPSTPSLMNERQGGYESQASSHSSFKQSPKPEDEFKV 400 >AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-specific zinc-fingerC isoform protein. Length = 593 Score = 24.6 bits (51), Expect = 2.7 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = -2 Query: 282 SASENQVSLAQKAQGAPQSSGKSHDEPKTAPKSAAEREI 166 ++S + SL + QG +S SH K +PK E ++ Sbjct: 314 NSSPSTPSLMNERQGGYESQASSHSSFKQSPKPEDEFKV 352 >AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-specific zinc-fingerC isoform protein. Length = 569 Score = 24.6 bits (51), Expect = 2.7 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = -2 Query: 282 SASENQVSLAQKAQGAPQSSGKSHDEPKTAPKSAAEREI 166 ++S + SL + QG +S SH K +PK E ++ Sbjct: 322 NSSPSTPSLMNERQGGYESQASSHSSFKQSPKPEDEFKV 360 >M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein. Length = 613 Score = 23.0 bits (47), Expect = 8.2 Identities = 10/35 (28%), Positives = 18/35 (51%) Frame = -3 Query: 221 GNLMTNPRRHQNQRQSEKSARGRLVESSMAVS*TY 117 G+ ++HQ Q+Q K + L+E S + T+ Sbjct: 364 GSSQQQQQQHQQQQQKRKRPKPELIEISPGQNETF 398 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 23.0 bits (47), Expect = 8.2 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -3 Query: 383 RSHFGVKRCWTTDGKII 333 R+HFG ++ WT D +I Sbjct: 1345 RNHFGKEKKWTFDKTLI 1361 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 658,728 Number of Sequences: 2352 Number of extensions: 11604 Number of successful extensions: 41 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 39 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 41 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 62723250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -