BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1045X (431 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_0621 - 4606739-4606894,4606976-4607098,4608199-4608288 40 9e-04 09_04_0038 - 13996505-13996836,13997047-13997077,13997307-139974... 29 1.6 12_01_1031 - 10605581-10606088,10606360-10606420,10606448-106064... 27 4.9 07_01_0163 + 1149466-1150593,1150733-1150937,1151453-1151485,115... 27 4.9 01_01_0474 - 3488739-3488876,3488996-3489118,3489878-3489991,349... 27 6.5 05_06_0017 + 24964168-24964275,24965384-24965506,24965617-24965751 27 8.6 >07_01_0621 - 4606739-4606894,4606976-4607098,4608199-4608288 Length = 122 Score = 39.9 bits (89), Expect = 9e-04 Identities = 17/39 (43%), Positives = 26/39 (66%) Frame = +1 Query: 76 ASEYNINSMPTYVFVKNG**LVDFSGANVDKLKTTILKH 192 A +YN+ +MPT++F+K+G GA D L+ TI+KH Sbjct: 74 AEKYNVEAMPTFLFIKDGAEADKVVGARKDDLQNTIVKH 112 >09_04_0038 - 13996505-13996836,13997047-13997077,13997307-13997420, 13997546-13997686,13997787-13997851,13997943-13998039, 13998096-13998257,13998360-13998473,14001263-14001311, 14001967-14002047,14003504-14003561,14003671-14004031, 14004129-14004213,14004320-14004591,14004712-14004914, 14005419-14005494 Length = 746 Score = 29.1 bits (62), Expect = 1.6 Identities = 12/39 (30%), Positives = 25/39 (64%) Frame = +1 Query: 76 ASEYNINSMPTYVFVKNG**LVDFSGANVDKLKTTILKH 192 A +N++S+P++ FV+NG + GA+ + L+ + +H Sbjct: 705 AYRWNVSSVPSFFFVRNGKEIDKVVGADKNGLERKVAQH 743 >12_01_1031 - 10605581-10606088,10606360-10606420,10606448-10606491, 10606664-10608382,10609848-10610791 Length = 1091 Score = 27.5 bits (58), Expect = 4.9 Identities = 14/37 (37%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = +1 Query: 85 YNINSM-PTYVFVKNG**LVDFSGANVDKLKTTILKH 192 Y+I + PT+ FVK+G + GAN + L+ I +H Sbjct: 1047 YDIEGIVPTFFFVKDGEKIDKIPGANKELLRAKIRRH 1083 >07_01_0163 + 1149466-1150593,1150733-1150937,1151453-1151485, 1152244-1153646 Length = 922 Score = 27.5 bits (58), Expect = 4.9 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -1 Query: 392 RELRDYNRTNIFCIPEAANTKNEYLEIH 309 +EL +++ +C P A+T EY IH Sbjct: 721 QELAQFHQRGFYCFPFVASTDPEYSRIH 748 >01_01_0474 - 3488739-3488876,3488996-3489118,3489878-3489991, 3490416-3490452,3490584-3490675,3490878-3490956, 3491640-3491734,3491858-3491991,3492560-3492833, 3493743-3494015,3494976-3495512 Length = 631 Score = 27.1 bits (57), Expect = 6.5 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +1 Query: 76 ASEYNINSMPTYVFVKNG**LVDFSGANVDKLKTTI 183 +S ++I + PT+ F+KNG + GAN +L+ + Sbjct: 589 SSSWDIRATPTFFFLKNGEQVDKLVGANKPELEKKV 624 >05_06_0017 + 24964168-24964275,24965384-24965506,24965617-24965751 Length = 121 Score = 26.6 bits (56), Expect = 8.6 Identities = 12/39 (30%), Positives = 23/39 (58%) Frame = +1 Query: 76 ASEYNINSMPTYVFVKNG**LVDFSGANVDKLKTTILKH 192 A ++++ +MPT++F+K G GA D+L + + H Sbjct: 80 AEQFSVEAMPTFLFMKEGDVKDRVVGAMKDELASKLELH 118 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,133,474 Number of Sequences: 37544 Number of extensions: 140290 Number of successful extensions: 366 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 362 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 365 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 814473264 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -