BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1045X (431 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF236124-1|AAF68382.1| 107|Anopheles gambiae thioredoxin 1 prot... 43 5e-06 AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein. 23 3.5 AY214334-1|AAP69612.1| 519|Anopheles gambiae nicotinate phospho... 22 8.1 AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcript... 22 8.1 AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcript... 22 8.1 >AF236124-1|AAF68382.1| 107|Anopheles gambiae thioredoxin 1 protein. Length = 107 Score = 42.7 bits (96), Expect = 5e-06 Identities = 19/39 (48%), Positives = 28/39 (71%) Frame = +1 Query: 76 ASEYNINSMPTYVFVKNG**LVDFSGANVDKLKTTILKH 192 A++YNI SMPT++F+K + FSGAN +KL+ I +H Sbjct: 67 AAQYNIASMPTFLFIKRKEVVGQFSGANAEKLENFIQQH 105 >AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein. Length = 1187 Score = 23.4 bits (48), Expect = 3.5 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +1 Query: 184 LKHKYHRD*SCTQPPMETKMELKKK 258 LK KYH+ + E K+E+KKK Sbjct: 887 LKAKYHQRDKLLKQNDELKLEIKKK 911 >AY214334-1|AAP69612.1| 519|Anopheles gambiae nicotinate phosphoribosyltransferase-like protein protein. Length = 519 Score = 22.2 bits (45), Expect = 8.1 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = +1 Query: 136 LVDFSGANVDKLKTTILKHK 195 + F+G +D+LKT +L+HK Sbjct: 192 ITSFTG--IDELKTRLLQHK 209 >AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcriptase protein. Length = 1168 Score = 22.2 bits (45), Expect = 8.1 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -2 Query: 70 PRTHQRPPSQRRWNLTFRRRS 8 PR+ + PPS R + RRR+ Sbjct: 1111 PRSRRLPPSPRTTEMRRRRRN 1131 >AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcriptase protein. Length = 1022 Score = 22.2 bits (45), Expect = 8.1 Identities = 15/43 (34%), Positives = 24/43 (55%), Gaps = 2/43 (4%) Frame = -3 Query: 180 SCFEFVDVSAREVDQLLAILNEDVR--RHRVNVVLAGDVLALI 58 + F + +ARE + L I+ + V+ RH N+V + D LA I Sbjct: 14 AAFNLMWQTAREREVDLFIVADPVKNQRHNNNIVYSEDQLAAI 56 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 360,850 Number of Sequences: 2352 Number of extensions: 5849 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 35717724 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -