BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1044X (500 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855501-1|ABH88188.1| 146|Tribolium castaneum chemosensory pro... 25 0.38 AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory recept... 21 6.2 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 8.2 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 8.2 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 8.2 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 8.2 AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 21 8.2 >DQ855501-1|ABH88188.1| 146|Tribolium castaneum chemosensory protein 15 protein. Length = 146 Score = 25.0 bits (52), Expect = 0.38 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +3 Query: 276 HGEEQKKNEIASFQHLSYYSPHDNLERKKYI 368 H + +E QHL + HD LER+ +I Sbjct: 115 HQSKFNPHEEVKLQHLHQFPHHDFLEREGFI 145 >AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory receptor candidate 36 protein. Length = 355 Score = 21.0 bits (42), Expect = 6.2 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = -3 Query: 276 GVISTYTKYFGVIIK 232 G+++T T YF VII+ Sbjct: 338 GILATITTYFIVIIE 352 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 20.6 bits (41), Expect = 8.2 Identities = 6/15 (40%), Positives = 11/15 (73%) Frame = +3 Query: 342 DNLERKKYIYFRFIS 386 +NLE+ +Y + F+S Sbjct: 289 ENLEQSRYFIYMFVS 303 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 20.6 bits (41), Expect = 8.2 Identities = 6/15 (40%), Positives = 11/15 (73%) Frame = +3 Query: 342 DNLERKKYIYFRFIS 386 +NLE+ +Y + F+S Sbjct: 289 ENLEQSRYFIYMFVS 303 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 20.6 bits (41), Expect = 8.2 Identities = 6/15 (40%), Positives = 11/15 (73%) Frame = +3 Query: 342 DNLERKKYIYFRFIS 386 +NLE+ +Y + F+S Sbjct: 289 ENLEQSRYFIYMFVS 303 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 20.6 bits (41), Expect = 8.2 Identities = 6/15 (40%), Positives = 11/15 (73%) Frame = +3 Query: 342 DNLERKKYIYFRFIS 386 +NLE+ +Y + F+S Sbjct: 289 ENLEQSRYFIYMFVS 303 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 20.6 bits (41), Expect = 8.2 Identities = 10/35 (28%), Positives = 20/35 (57%) Frame = +1 Query: 289 KKKTKSLLFSIFHIIAHMIIWKEKNIYIFVSFHFF 393 KKK ++ +S+ +I H +++ +Y+ HFF Sbjct: 318 KKKLEN--YSL-QLINHRVVFTAMGLYVLNMEHFF 349 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 129,099 Number of Sequences: 336 Number of extensions: 3062 Number of successful extensions: 8 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 11839801 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -