BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1044X (500 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_42543| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.6 SB_36079| Best HMM Match : Peptidase_C48 (HMM E-Value=0.097) 28 5.0 >SB_42543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 29.5 bits (63), Expect = 1.6 Identities = 16/57 (28%), Positives = 29/57 (50%) Frame = +1 Query: 280 AKNKKKTKSLLFSIFHIIAHMIIWKEKNIYIFVSFHFF*SSLKSQRFYRSFTSIYTF 450 A++ K+T+ +L S ++ H + + NIYI + + K +RFY T + F Sbjct: 261 ARSSKRTEGVLLSTVDLVKHDGLQPDANIYIAILGKVY-DVEKGRRFYGPGTGYHVF 316 >SB_36079| Best HMM Match : Peptidase_C48 (HMM E-Value=0.097) Length = 796 Score = 27.9 bits (59), Expect = 5.0 Identities = 15/50 (30%), Positives = 24/50 (48%) Frame = +3 Query: 288 QKKNEIASFQHLSYYSPHDNLERKKYIYFRFISFLLIEFKITTIL*KFHF 437 Q+ ++ QHLSY D L K + + S +L + K T + K H+ Sbjct: 255 QQWDDEGELQHLSYAVVSDELSHDKSSVYAYNSLILEDVKKVTEVKKVHY 304 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,022,464 Number of Sequences: 59808 Number of extensions: 294419 Number of successful extensions: 661 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 552 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 659 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1087245449 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -