BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1043X (508 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g15096.1 68417.m02320 hypothetical protein 27 5.5 At5g22920.1 68418.m02680 zinc finger (C3HC4-type RING finger) fa... 27 9.6 >At4g15096.1 68417.m02320 hypothetical protein Length = 679 Score = 27.5 bits (58), Expect = 5.5 Identities = 16/38 (42%), Positives = 23/38 (60%) Frame = -2 Query: 465 MIFLLSVYNFFVLMKNYVRQLLMTLNHRAHLGKFFVLN 352 M+F L F L +++ RQLL+ L H A L K F+L+ Sbjct: 536 MMFNLKKKGRFRLFQSFSRQLLLWLRHDALLIKPFLLS 573 >At5g22920.1 68418.m02680 zinc finger (C3HC4-type RING finger) family protein contains Pfam profiles:PF05495 CHY zinc finger, PF00097 zinc finger, C3HC4 type (RING finger) Length = 291 Score = 26.6 bits (56), Expect = 9.6 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +1 Query: 4 CPTCFESMIDRHSSRALEVFKCDFT 78 CP CFE + D S+R + V +C T Sbjct: 163 CPVCFEYLFD--STRDITVLRCGHT 185 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,676,359 Number of Sequences: 28952 Number of extensions: 165856 Number of successful extensions: 259 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 257 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 259 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 908059136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -