BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1042 (535 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_51558| Best HMM Match : DSS1_SEM1 (HMM E-Value=0.2) 29 1.8 SB_50520| Best HMM Match : zf-DNL (HMM E-Value=3.4) 28 4.2 >SB_51558| Best HMM Match : DSS1_SEM1 (HMM E-Value=0.2) Length = 878 Score = 29.5 bits (63), Expect = 1.8 Identities = 13/35 (37%), Positives = 23/35 (65%) Frame = -1 Query: 535 THPIYVPQINNEHQKYLIASLSTKKKSLNNFLIYS 431 T+P+ V ++N + +KYL +S +KK + + LI S Sbjct: 7 TNPVSVNRMNEDIKKYLDKEMSDEKKMIQDLLIGS 41 >SB_50520| Best HMM Match : zf-DNL (HMM E-Value=3.4) Length = 277 Score = 28.3 bits (60), Expect = 4.2 Identities = 18/68 (26%), Positives = 39/68 (57%), Gaps = 3/68 (4%) Frame = -1 Query: 499 HQKYLIASLSTKKKSLNN--FLIYSFIYIQKKRYYIFRFMV*NIILSNTYNILNIFFSC- 329 H + + +S ++ L+ F I + I++Q + + R ++ II N Y+ +++FF+C Sbjct: 164 HARGEVKEISRREMLLHGDIFGILTGIFMQDGPFLVLRLVL--IIKYNLYSEMHLFFTCK 221 Query: 328 NVIAIHVI 305 N IA+ ++ Sbjct: 222 NAIALSLL 229 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,329,145 Number of Sequences: 59808 Number of extensions: 164179 Number of successful extensions: 223 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 205 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 223 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1203486867 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -