BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1042 (535 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/p... 24 2.8 AF515734-1|AAO14865.1| 1325|Anopheles gambiae xanthine dehydroge... 23 8.5 >AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/proton exchanger 3 protein. Length = 1221 Score = 24.2 bits (50), Expect = 2.8 Identities = 14/56 (25%), Positives = 28/56 (50%) Frame = +3 Query: 228 SLAYSEH*NINCKIYCLIVSC**LMFITCIAITLQEKKIFKILYVLLKIIFQTIKR 395 ++++ H I + L S ++F+ T+ K ++ +VLL IIF ++ R Sbjct: 516 NVSHKSHTTIKYALKMLSSSAETIIFMFLGVATVNNKHVWNTWFVLLTIIFCSVYR 571 >AF515734-1|AAO14865.1| 1325|Anopheles gambiae xanthine dehydrogenase protein. Length = 1325 Score = 22.6 bits (46), Expect = 8.5 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -3 Query: 224 TGFVQNIIIPLECLAKVSVDRT 159 TG+ +N+I P E L + + RT Sbjct: 379 TGYRKNVIQPHEALVSLFIPRT 400 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 409,624 Number of Sequences: 2352 Number of extensions: 6282 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 49474503 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -