BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1040X (405 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF025460-6|AAB70989.1| 130|Caenorhabditis elegans Ribosomal pro... 97 3e-21 L14433-3|AAA27977.1| 2329|Caenorhabditis elegans Yeast prp (spli... 27 5.1 >AF025460-6|AAB70989.1| 130|Caenorhabditis elegans Ribosomal protein, small subunitprotein 22 protein. Length = 130 Score = 97.5 bits (232), Expect = 3e-21 Identities = 45/50 (90%), Positives = 47/50 (94%) Frame = +2 Query: 254 RPCSKVIVKFLTVMMKHGYIGEFEIVDDHRAGKIVVNLTGRLNQCGVISP 403 RP SKVIV+FLTVMMKHGYIGEFEIVDDHRAGKIVVNLTGRLN+ VISP Sbjct: 28 RPASKVIVRFLTVMMKHGYIGEFEIVDDHRAGKIVVNLTGRLNKASVISP 77 Score = 53.6 bits (123), Expect = 5e-08 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = +3 Query: 174 MVRMNVLSDALKSIHNAEKRGKRQVLIGPVPKSSLSF 284 MVRMNVL+DAL +I+NAEKRGKRQVLI P K + F Sbjct: 1 MVRMNVLADALNAINNAEKRGKRQVLIRPASKVIVRF 37 >L14433-3|AAA27977.1| 2329|Caenorhabditis elegans Yeast prp (splicing factor) relatedprotein 8 protein. Length = 2329 Score = 27.1 bits (57), Expect = 5.1 Identities = 14/46 (30%), Positives = 25/46 (54%) Frame = +3 Query: 84 ILSDTLFPLKSYKNN*HSSDNLLFHGVLTTMVRMNVLSDALKSIHN 221 + +T+ P KSYK N +D LLF + R ++++D+ + N Sbjct: 1602 VQKETIHPRKSYKMNSSCADVLLFAQYKWNVSRPSLMADSKDVMDN 1647 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,187,399 Number of Sequences: 27780 Number of extensions: 141543 Number of successful extensions: 264 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 260 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 264 length of database: 12,740,198 effective HSP length: 74 effective length of database: 10,684,478 effective search space used: 641068680 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -