BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1036 (771 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q86QT4 Cluster: Putative uncharacterized protein; n=1; ... 40 0.091 UniRef50_Q86QT5 Cluster: Putative uncharacterized protein; n=1; ... 36 1.5 UniRef50_Q7WYU1 Cluster: CirB protein; n=1; Clostridium beijerin... 34 4.5 >UniRef50_Q86QT4 Cluster: Putative uncharacterized protein; n=1; Bombyx mori|Rep: Putative uncharacterized protein - Bombyx mori (Silk moth) Length = 47 Score = 39.5 bits (88), Expect = 0.091 Identities = 18/26 (69%), Positives = 20/26 (76%) Frame = +1 Query: 202 LKLENGWTDLDNFSLELLWKSREGLK 279 LKLENGWTDL NF LEL + + GLK Sbjct: 20 LKLENGWTDLANFGLELPVEVQRGLK 45 >UniRef50_Q86QT5 Cluster: Putative uncharacterized protein; n=1; Bombyx mori|Rep: Putative uncharacterized protein - Bombyx mori (Silk moth) Length = 77 Score = 35.5 bits (78), Expect = 1.5 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -2 Query: 374 KNKRIRPTGDTSKEKQNCLF 315 + K IR TGDTSKEKQNC F Sbjct: 48 QTKGIRQTGDTSKEKQNCYF 67 >UniRef50_Q7WYU1 Cluster: CirB protein; n=1; Clostridium beijerinckii|Rep: CirB protein - Clostridium beijerinckii (Clostridium MP) Length = 581 Score = 33.9 bits (74), Expect = 4.5 Identities = 23/68 (33%), Positives = 34/68 (50%) Frame = +2 Query: 536 KYFKYYTYVSLKVYRHISITVSIYLKNSGEVKFLTLNFNFHVIRVVKNIVSQIRGRKRIK 715 KY KYY Y+H +I +IYLK K + L FN + V+K++ I+G +K Sbjct: 292 KYIKYY-------YKHNNIIPNIYLKYINIHKKINLFFNSNNKLVLKDLNILIKGDNELK 344 Query: 716 IRSFNVNV 739 F V + Sbjct: 345 TNFFTVTL 352 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 616,112,922 Number of Sequences: 1657284 Number of extensions: 10652402 Number of successful extensions: 24747 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 23423 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24710 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 64615845515 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -