BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1036 (771 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g79990.1 68414.m09356 coatomer protein complex, subunit beta ... 32 0.48 >At1g79990.1 68414.m09356 coatomer protein complex, subunit beta 2 (beta prime), putative contains 7 WD-40 repeats (PF00400) (1 weak); similar to Coatomer beta' subunit (Beta'-coat protein) (Beta'-COP) (p102) (SP:P35606) [Homo sapiens]; similar to Coatomer beta' subunit (Beta'-coat protein) (Beta'-COP) (p102) (SP:O55029) [Mus musculus] Length = 920 Score = 31.9 bits (69), Expect = 0.48 Identities = 18/68 (26%), Positives = 39/68 (57%), Gaps = 2/68 (2%) Frame = +2 Query: 515 LTFC*YHKYFKYYTYVSLKVYRHISITV-SIYLKNSGEVKFLTLNFNFHVIRVVKNIVSQ 691 LT C + +Y + ++ R I +TV ++Y +SG++ + + +F++++ ++IVS Sbjct: 439 LTMC-SSDFICFYDWAECRLIRRIDVTVKNLYWADSGDLVAIASDTSFYILKFNRDIVSS 497 Query: 692 -IRGRKRI 712 G K+I Sbjct: 498 YFDGGKQI 505 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,280,818 Number of Sequences: 28952 Number of extensions: 231835 Number of successful extensions: 456 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 453 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 456 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1716774400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -