SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= br--1036
         (771 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g79990.1 68414.m09356 coatomer protein complex, subunit beta ...    32   0.48 

>At1g79990.1 68414.m09356 coatomer protein complex, subunit beta 2
           (beta prime), putative contains 7 WD-40 repeats
           (PF00400) (1 weak); similar to Coatomer beta' subunit
           (Beta'-coat protein) (Beta'-COP) (p102) (SP:P35606)
           [Homo sapiens]; similar to Coatomer beta' subunit
           (Beta'-coat protein) (Beta'-COP) (p102) (SP:O55029) [Mus
           musculus]
          Length = 920

 Score = 31.9 bits (69), Expect = 0.48
 Identities = 18/68 (26%), Positives = 39/68 (57%), Gaps = 2/68 (2%)
 Frame = +2

Query: 515 LTFC*YHKYFKYYTYVSLKVYRHISITV-SIYLKNSGEVKFLTLNFNFHVIRVVKNIVSQ 691
           LT C    +  +Y +   ++ R I +TV ++Y  +SG++  +  + +F++++  ++IVS 
Sbjct: 439 LTMC-SSDFICFYDWAECRLIRRIDVTVKNLYWADSGDLVAIASDTSFYILKFNRDIVSS 497

Query: 692 -IRGRKRI 712
              G K+I
Sbjct: 498 YFDGGKQI 505


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,280,818
Number of Sequences: 28952
Number of extensions: 231835
Number of successful extensions: 456
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 453
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 456
length of database: 12,070,560
effective HSP length: 80
effective length of database: 9,754,400
effective search space used: 1716774400
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -