BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1035 (351 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_38068| Best HMM Match : UreE_N (HMM E-Value=0.46) 27 5.7 SB_28495| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.9 >SB_38068| Best HMM Match : UreE_N (HMM E-Value=0.46) Length = 413 Score = 26.6 bits (56), Expect = 5.7 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = -1 Query: 195 DIAIMSKQFQMHY*NHEMCFNFLTNQL 115 ++A+ S+QF + NH + F+ NQL Sbjct: 37 NVALQSRQFFLQISNHSCVYYFIKNQL 63 >SB_28495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6753 Score = 25.8 bits (54), Expect = 9.9 Identities = 11/42 (26%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = +1 Query: 109 IVELVGQEIKTH-FMISIVHLELFAHYSNVEFCKIFDNC*FY 231 ++E+ Q + H F++ L F + +E C++ D C Y Sbjct: 3021 LLEIASQPVDNHVFIMPYSKLASFVKRTKLEICQVADQCSSY 3062 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,189,651 Number of Sequences: 59808 Number of extensions: 131404 Number of successful extensions: 179 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 167 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 179 length of database: 16,821,457 effective HSP length: 73 effective length of database: 12,455,473 effective search space used: 535585339 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -